DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trx-2 and TRX-M4

DIOPT Version :9

Sequence 1:NP_523526.1 Gene:Trx-2 / 34281 FlyBaseID:FBgn0040070 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_188155.1 Gene:TRX-M4 / 820775 AraportID:AT3G15360 Length:193 Species:Arabidopsis thaliana


Alignment Length:103 Identity:37/103 - (35%)
Similarity:57/103 - (55%) Gaps:4/103 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QVKDKADLDGQLTKA--SGKLVVLDFFATWCGPCKMISPKLVELSTQFADNVVVLKVDVDECEDI 66
            :|.:.:|.:.| ||.  |...|:::|:|.|||||:||.|.:.:|:..||......|::.||..:.
plant    87 EVPNLSDSEWQ-TKVLESDVPVLVEFWAPWCGPCRMIHPIVDQLAKDFAGKFKFYKINTDESPNT 150

  Fly    67 AMEYNISSMPTFVFLKNGVKVEEFAGANAKR-LEDVIK 103
            |..|.|.|:||.:..|.|.|.:...||..:. ||..|:
plant   151 ANRYGIRSVPTVIIFKGGEKKDSIIGAVPRETLEKTIE 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trx-2NP_523526.1 TRX_family 18..103 CDD:239245 31/87 (36%)
TRX-M4NP_188155.1 thioredoxin 91..191 CDD:200072 36/99 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100096
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.