DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trx-2 and ACHT3

DIOPT Version :9

Sequence 1:NP_523526.1 Gene:Trx-2 / 34281 FlyBaseID:FBgn0040070 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_180885.1 Gene:ACHT3 / 817890 AraportID:AT2G33270 Length:273 Species:Arabidopsis thaliana


Alignment Length:92 Identity:31/92 - (33%)
Similarity:49/92 - (53%) Gaps:2/92 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VKDKADLDGQLTKASGKLVVLDFFATWCGPCKMISPKLVELSTQFADNVVVLKVDVDECEDIAME 69
            |....||...|..|..||||:|||:..||.||.:.||:.:::.:..: |..|:|:.:|...:...
plant    98 VTSPQDLVVSLRNAGDKLVVVDFFSPSCGGCKALHPKICKIAEKNPE-VEFLQVNYEEHRSLCQS 161

  Fly    70 YNISSMPTFVFLK-NGVKVEEFAGANA 95
            .||..:|.|.|.: :..:|..|:..||
plant   162 LNIHVLPFFRFYRGSSGRVCSFSCTNA 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trx-2NP_523526.1 TRX_family 18..103 CDD:239245 27/79 (34%)
ACHT3NP_180885.1 TRX_family 111..>175 CDD:239245 23/64 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0907
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.780

Return to query results.
Submit another query.