DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trx2 and ATHM3

DIOPT Version :10

Sequence 1:NP_523526.1 Gene:Trx2 / 34281 FlyBaseID:FBgn0040070 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_001154520.1 Gene:ATHM3 / 816050 AraportID:AT2G15570 Length:174 Species:Arabidopsis thaliana


Alignment Length:74 Identity:23/74 - (31%)
Similarity:41/74 - (55%) Gaps:0/74 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 VVLDFFATWCGPCKMISPKLVELSTQFADNVVVLKVDVDECEDIAMEYNISSMPTFVFLKNGVKV 87
            |:::|:.:|||||:|:...:.|::..:|..:....::.|....:|.||.|.::|..:..|||.|.
plant    88 VLVEFYTSWCGPCRMVHRIIDEIAGDYAGKLNCYLLNADNDLPVAEEYEIKAVPVVLLFKNGEKR 152

  Fly    88 EEFAGANAK 96
            |...|...|
plant   153 ESIMGTMPK 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trx2NP_523526.1 TRX_family 18..103 CDD:239245 23/74 (31%)
ATHM3NP_001154520.1 CnoX 71..172 CDD:442352 23/74 (31%)

Return to query results.
Submit another query.