DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trx-2 and Txnl1

DIOPT Version :9

Sequence 1:NP_523526.1 Gene:Trx-2 / 34281 FlyBaseID:FBgn0040070 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_058072.2 Gene:Txnl1 / 53382 MGIID:1860078 Length:289 Species:Mus musculus


Alignment Length:105 Identity:38/105 - (36%)
Similarity:61/105 - (58%) Gaps:1/105 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VYQVKDKADLDGQLTKASGKLVVLDFFATWCGPCKMISPKLVELSTQFADNVVVLKVDVDECEDI 66
            |..|....|...:|:.|..:|.|:.|....||||..|:|....:|.:: ...|.|:|||.:|:..
Mouse     4 VKPVGSDPDFQPELSGAGSRLAVVKFTMRGCGPCLRIAPAFSSMSNKY-PQAVFLEVDVHQCQGT 67

  Fly    67 AMEYNISSMPTFVFLKNGVKVEEFAGANAKRLEDVIKANI 106
            |...|||:.|||:|.:|.|:::::.||:|..||:.||.::
Mouse    68 AATNNISATPTFLFFRNKVRIDQYQGADAVGLEEKIKQHL 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trx-2NP_523526.1 TRX_family 18..103 CDD:239245 32/84 (38%)
Txnl1NP_058072.2 TRX_family 12..104 CDD:239245 34/92 (37%)
PITH 128..268 CDD:399305
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100096
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1557
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.