DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trx-2 and pdia7

DIOPT Version :9

Sequence 1:NP_523526.1 Gene:Trx-2 / 34281 FlyBaseID:FBgn0040070 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_998070.1 Gene:pdia7 / 405841 ZFINID:ZDB-GENE-040426-2238 Length:488 Species:Danio rerio


Alignment Length:96 Identity:28/96 - (29%)
Similarity:47/96 - (48%) Gaps:3/96 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ADLDGQLTKASGKLVVLDFFATWCGPCKMISPKLVELSTQFA--DNVVVLKVDVDECEDIAMEYN 71
            ||....:.....|.|:::|:|.|||.||.:.||..||..:.:  .|:|:.|:|. ...|:...|:
Zfish   374 ADTFDAIVNDPEKDVLVEFYAPWCGHCKNLEPKYKELGEKLSGNPNIVIAKMDA-TANDVPPNYD 437

  Fly    72 ISSMPTFVFLKNGVKVEEFAGANAKRLEDVI 102
            :...||..|:.:|.|.:.......:.:.|.|
Zfish   438 VQGFPTIYFVPSGQKDQPRRYEGGREVNDFI 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trx-2NP_523526.1 TRX_family 18..103 CDD:239245 26/87 (30%)
pdia7NP_998070.1 ER_PDI_fam 20..483 CDD:273457 28/96 (29%)
Thioredoxin_like 25..124 CDD:294274
PDI_b_ERp57 127..231 CDD:239367
PDI_b'_ERp72_ERp57 235..348 CDD:239371
PDI_a_PDI_a'_C 368..471 CDD:239293 28/96 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.