DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trx-2 and txn2

DIOPT Version :9

Sequence 1:NP_523526.1 Gene:Trx-2 / 34281 FlyBaseID:FBgn0040070 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_991204.1 Gene:txn2 / 402938 ZFINID:ZDB-GENE-040426-1795 Length:166 Species:Danio rerio


Alignment Length:90 Identity:32/90 - (35%)
Similarity:56/90 - (62%) Gaps:1/90 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 YQVKDKADLDGQLTKASGKLVVLDFFATWCGPCKMISPKLVELSTQFADNVVVLKVDVDECEDIA 67
            :.|:|..|...::.. |...|::||.|.||||||::.|:|.:...:....|.:.|||:||..|:|
Zfish    61 FNVQDHDDFTERVIN-SELPVLIDFHAQWCGPCKILGPRLEKAIAKQKGRVTMAKVDIDEHTDLA 124

  Fly    68 MEYNISSMPTFVFLKNGVKVEEFAG 92
            :||.:|::||.:.::.|..:::|.|
Zfish   125 IEYGVSAVPTVIAMRGGDVIDQFVG 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trx-2NP_523526.1 TRX_family 18..103 CDD:239245 29/75 (39%)
txn2NP_991204.1 TRX_family 67..161 CDD:239245 30/84 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100096
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.