DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trx-2 and txnl1

DIOPT Version :9

Sequence 1:NP_523526.1 Gene:Trx-2 / 34281 FlyBaseID:FBgn0040070 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_957432.2 Gene:txnl1 / 394113 ZFINID:ZDB-GENE-040426-701 Length:289 Species:Danio rerio


Alignment Length:102 Identity:38/102 - (37%)
Similarity:62/102 - (60%) Gaps:1/102 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VKDKADLDGQLTKASGKLVVLDFFATWCGPCKMISPKLVELSTQFADNVVVLKVDVDECEDIAME 69
            :.:.:|...:|:.|..:|.|:.|..:.|.||..|:|....||.:: ..||.|:|||..|:..|..
Zfish     7 IGNDSDFQAELSGAGSRLTVVKFTMSGCRPCVRIAPAFNMLSNKY-PQVVFLEVDVHVCQATAAA 70

  Fly    70 YNISSMPTFVFLKNGVKVEEFAGANAKRLEDVIKANI 106
            .|||:.|||:|.:|.|:|:::.||:|..||:.||.::
Zfish    71 NNISATPTFLFFRNKVRVDQYQGADASGLEEKIKQHV 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trx-2NP_523526.1 TRX_family 18..103 CDD:239245 34/84 (40%)
txnl1NP_957432.2 TRX_family 11..104 CDD:239245 36/93 (39%)
PITH 126..268 CDD:283785
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100096
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1557
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.