DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trx-2 and CG8517

DIOPT Version :9

Sequence 1:NP_523526.1 Gene:Trx-2 / 34281 FlyBaseID:FBgn0040070 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_611446.3 Gene:CG8517 / 37268 FlyBaseID:FBgn0034472 Length:145 Species:Drosophila melanogaster


Alignment Length:91 Identity:30/91 - (32%)
Similarity:57/91 - (62%) Gaps:1/91 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VYQVKDKADLDGQLTKASGKLVVLDFFATWCGPCKMISPKLVELSTQFADNVVVLKVDVDECEDI 66
            ::.|:.:.|.:.::.. |.:.||:||.|:||.|||.::|:|..:.::....|.:.:||:||..::
  Fly    31 IFDVETRKDFEQRVIN-SDRPVVVDFHASWCCPCKALAPRLENVVSEQEGRVRLARVDIDEHGEL 94

  Fly    67 AMEYNISSMPTFVFLKNGVKVEEFAG 92
            |::||:.|:|:.|.:.||..|....|
  Fly    95 ALDYNVGSVPSLVVISNGKVVNRMVG 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trx-2NP_523526.1 TRX_family 18..103 CDD:239245 28/75 (37%)
CG8517NP_611446.3 Thioredoxin_like 36..135 CDD:412351 29/86 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464320
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100096
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.