DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trx-2 and ERp60

DIOPT Version :9

Sequence 1:NP_523526.1 Gene:Trx-2 / 34281 FlyBaseID:FBgn0040070 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_725084.2 Gene:ERp60 / 36270 FlyBaseID:FBgn0033663 Length:489 Species:Drosophila melanogaster


Alignment Length:86 Identity:26/86 - (30%)
Similarity:48/86 - (55%) Gaps:2/86 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 SGKLVVLDFFATWCGPCKMISPKLVELSTQFAD-NVVVLKVDVDECEDIAMEYNISSMPTFVFLK 82
            :||..:::|:|.|||.||.:||...||:.:..| :|.::|:|. ...|:..|:|:...||..:|.
  Fly   381 NGKDTLIEFYAPWCGHCKKLSPIYEELAEKLQDEDVAIVKMDA-TANDVPPEFNVRGFPTLFWLP 444

  Fly    83 NGVKVEEFAGANAKRLEDVIK 103
            ...|.:..:....:.::|.:|
  Fly   445 KDAKNKPVSYNGGREVDDFLK 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trx-2NP_523526.1 TRX_family 18..103 CDD:239245 25/84 (30%)
ERp60NP_725084.2 ER_PDI_fam 23..479 CDD:273457 26/86 (30%)
PDI_a_PDIR 23..126 CDD:239295
PDI_b_ERp57 133..235 CDD:239367
PDI_b'_ERp72_ERp57 239..345 CDD:239371
PDI_a_PDI_a'_C 365..467 CDD:239293 26/86 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.