DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trx-2 and NME9

DIOPT Version :9

Sequence 1:NP_523526.1 Gene:Trx-2 / 34281 FlyBaseID:FBgn0040070 Length:106 Species:Drosophila melanogaster
Sequence 2:XP_016861795.1 Gene:NME9 / 347736 HGNCID:21343 Length:353 Species:Homo sapiens


Alignment Length:96 Identity:29/96 - (30%)
Similarity:40/96 - (41%) Gaps:22/96 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 ASGKLVVLDFFATWCGPCK-----------MISPKLVELSTQFADNVVVLKVDVDECEDIAMEYN 71
            :|..|.|:|.:..||||||           .:...|:..:...||.:.||:....:||       
Human    37 SSKGLTVVDVYQGWCGPCKPVVSLFQKMRIEVGLDLLHFALAEADRLDVLEKYRGKCE------- 94

  Fly    72 ISSMPTFVFLKNGVKVEEFAGANAKRLEDVI 102
                |||:|...|..|....||||..|:..|
Human    95 ----PTFLFYAGGELVAVVRGANAPLLQKTI 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trx-2NP_523526.1 TRX_family 18..103 CDD:239245 29/96 (30%)
NME9XP_016861795.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0907
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.