DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trx-2 and zgc:56493

DIOPT Version :9

Sequence 1:NP_523526.1 Gene:Trx-2 / 34281 FlyBaseID:FBgn0040070 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_956317.1 Gene:zgc:56493 / 336637 ZFINID:ZDB-GENE-030131-8581 Length:108 Species:Danio rerio


Alignment Length:104 Identity:49/104 - (47%)
Similarity:68/104 - (65%) Gaps:1/104 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVYQVKDKADLDGQLTKASGKLVVLDFFATWCGPCKMISPKLVELS-TQFADNVVVLKVDVDECE 64
            |:..::|:...|..|..|..||||:||.|||||||:.|:|....|| .....|||.||||||:.:
Zfish     1 MIVVIEDQDGFDKALAGAGDKLVVVDFTATWCGPCQSIAPFYKGLSENPDYSNVVFLKVDVDDAQ 65

  Fly    65 DIAMEYNISSMPTFVFLKNGVKVEEFAGANAKRLEDVIK 103
            |:|....|..||||.|.|||.|:::|:|:|..:||:::|
Zfish    66 DVAQSCEIKCMPTFHFYKNGKKLDDFSGSNQTKLEEMVK 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trx-2NP_523526.1 TRX_family 18..103 CDD:239245 44/85 (52%)
zgc:56493NP_956317.1 TRX_family 11..104 CDD:239245 46/92 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 98 1.000 Domainoid score I7106
eggNOG 1 0.900 - - E2759_KOG0907
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H128202
Inparanoid 1 1.050 107 1.000 Inparanoid score I4899
OMA 1 1.010 - - QHG54229
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 1 1.000 - - mtm6569
orthoMCL 1 0.900 - - OOG6_100096
Panther 1 1.100 - - LDO PTHR10438
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1557
SonicParanoid 1 1.000 - - X356
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.870

Return to query results.
Submit another query.