DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trx-2 and CG18130

DIOPT Version :9

Sequence 1:NP_523526.1 Gene:Trx-2 / 34281 FlyBaseID:FBgn0040070 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_572772.1 Gene:CG18130 / 32161 FlyBaseID:FBgn0030359 Length:706 Species:Drosophila melanogaster


Alignment Length:81 Identity:19/81 - (23%)
Similarity:39/81 - (48%) Gaps:0/81 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LVVLDFFATWCGPCKMISPKLVELSTQFADNVVVLKVDVDECEDIAMEYNISSMPTFVFLKNGVK 86
            |:|||.::.|||||:.:...|.::......:.:.|.:...:.......:|..|.|.::|:..|..
  Fly    29 LLVLDVYSEWCGPCQGMVGSLRKIKLDVGGDNLHLAICKSDTITALKRFNKRSEPIWLFVTGGRA 93

  Fly    87 VEEFAGANAKRLEDVI 102
            |....|::..:|..::
  Fly    94 VNLLFGSDVPKLVSLL 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trx-2NP_523526.1 TRX_family 18..103 CDD:239245 19/81 (23%)
CG18130NP_572772.1 TRX_NDPK 11..112 CDD:239246 19/81 (23%)
DUF4746 234..556 CDD:292550
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0907
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.