DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trx-2 and Txndc2

DIOPT Version :9

Sequence 1:NP_523526.1 Gene:Trx-2 / 34281 FlyBaseID:FBgn0040070 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_001139476.1 Gene:Txndc2 / 316777 RGDID:1359251 Length:550 Species:Rattus norvegicus


Alignment Length:102 Identity:43/102 - (42%)
Similarity:61/102 - (59%) Gaps:1/102 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVYQVKDKADLDGQLTKASGKLVVLDFFATWCGPCKMISPKLVELSTQFADNVVVLKVDVDECED 65
            ||..:|||.:.:..|..|..|||.:||.|.|||||:.:.|....||.:..| |:.|:||.::||.
  Rat   446 MVRVIKDKEEFEEVLKDAGEKLVAVDFSAPWCGPCRKMRPHFHSLSLKHED-VIFLEVDTEDCEQ 509

  Fly    66 IAMEYNISSMPTFVFLKNGVKVEEFAGANAKRLEDVI 102
            :..:..:..:|||.|.||..||.||:||..::||..|
  Rat   510 LVQDCEVFHLPTFQFYKNEEKVGEFSGALVEKLEKSI 546

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trx-2NP_523526.1 TRX_family 18..103 CDD:239245 37/85 (44%)
Txndc2NP_001139476.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..50
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..428
22 X 15 AA approximate tandem repeat of Q-P-K-X-G-D-I-P-K-S-[PS]-E-[KE]-X-I 104..440
PTZ00121 <151..466 CDD:173412 7/19 (37%)
TRX_family 454..547 CDD:239245 38/94 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10438
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.