DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trx2 and Txndc2

DIOPT Version :10

Sequence 1:NP_523526.1 Gene:Trx2 / 34281 FlyBaseID:FBgn0040070 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_001139476.1 Gene:Txndc2 / 316777 RGDID:1359251 Length:550 Species:Rattus norvegicus


Alignment Length:102 Identity:43/102 - (42%)
Similarity:61/102 - (59%) Gaps:1/102 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVYQVKDKADLDGQLTKASGKLVVLDFFATWCGPCKMISPKLVELSTQFADNVVVLKVDVDECED 65
            ||..:|||.:.:..|..|..|||.:||.|.|||||:.:.|....||.:..| |:.|:||.::||.
  Rat   446 MVRVIKDKEEFEEVLKDAGEKLVAVDFSAPWCGPCRKMRPHFHSLSLKHED-VIFLEVDTEDCEQ 509

  Fly    66 IAMEYNISSMPTFVFLKNGVKVEEFAGANAKRLEDVI 102
            :..:..:..:|||.|.||..||.||:||..::||..|
  Rat   510 LVQDCEVFHLPTFQFYKNEEKVGEFSGALVEKLEKSI 546

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trx2NP_523526.1 TRX_family 18..103 CDD:239245 37/85 (44%)
Txndc2NP_001139476.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..50
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..428
22 X 15 AA approximate tandem repeat of Q-P-K-X-G-D-I-P-K-S-[PS]-E-[KE]-X-I 104..440
PTZ00121 <151..466 CDD:173412 7/19 (37%)
TRX_family 454..547 CDD:239245 38/94 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.