DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trx-2 and TrxT

DIOPT Version :9

Sequence 1:NP_523526.1 Gene:Trx-2 / 34281 FlyBaseID:FBgn0040070 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_001284881.1 Gene:TrxT / 31443 FlyBaseID:FBgn0029752 Length:157 Species:Drosophila melanogaster


Alignment Length:103 Identity:61/103 - (59%)
Similarity:81/103 - (78%) Gaps:0/103 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVYQVKDKADLDGQLTKASGKLVVLDFFATWCGPCKMISPKLVELSTQFADNVVVLKVDVDECED 65
            |||.|::|.|||.||..|..||||:||:|.||||||:|:|||.||:.|::|.||||||:|||.||
  Fly     1 MVYPVRNKDDLDQQLILAEDKLVVIDFYADWCGPCKIIAPKLDELAQQYSDRVVVLKVNVDENED 65

  Fly    66 IAMEYNISSMPTFVFLKNGVKVEEFAGANAKRLEDVIK 103
            |.:|||::|||||||:|.|..:|.|.|.|:.:|..:::
  Fly    66 ITVEYNVNSMPTFVFIKGGNVLELFVGCNSDKLAKLME 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trx-2NP_523526.1 TRX_family 18..103 CDD:239245 51/84 (61%)
TrxTNP_001284881.1 Thioredoxin 13..105 CDD:278513 53/91 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443461
Domainoid 1 1.000 89 1.000 Domainoid score I2685
eggNOG 1 0.900 - - E2759_KOG0907
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 94 1.000 Inparanoid score I2234
Isobase 1 0.950 - 0.985475 Normalized mean entropy S646
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D146939at50557
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 1 1.000 - - mtm6569
orthoMCL 1 0.900 - - OOG6_100096
Panther 1 1.100 - - P PTHR10438
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X356
1211.750

Return to query results.
Submit another query.