DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trx-2 and Pdia3

DIOPT Version :9

Sequence 1:NP_523526.1 Gene:Trx-2 / 34281 FlyBaseID:FBgn0040070 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_059015.2 Gene:Pdia3 / 29468 RGDID:68430 Length:510 Species:Rattus norvegicus


Alignment Length:90 Identity:27/90 - (30%)
Similarity:42/90 - (46%) Gaps:3/90 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LTKASGKLVVLDFFATWCGPCKMISPKLVELSTQFA--DNVVVLKVDVDECEDIAMEYNISSMPT 77
            :..|..|.|:::|:|.|||.||.:.||..||..:.:  .|:|:.|:|. ...|:...|.:...||
  Rat   394 IVNAEDKDVLIEFYAPWCGHCKNLEPKYKELGEKLSKDPNIVIAKMDA-TANDVPSPYEVKGFPT 457

  Fly    78 FVFLKNGVKVEEFAGANAKRLEDVI 102
            ..|.....|:........:.|.|.|
  Rat   458 IYFSPANKKLTPKKYEGGRELNDFI 482

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trx-2NP_523526.1 TRX_family 18..103 CDD:239245 27/87 (31%)
Pdia3NP_059015.2 ER_PDI_fam 31..492 CDD:273457 27/90 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 489..510
Prevents secretion from ER 507..510
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.