DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trx-2 and trx1

DIOPT Version :9

Sequence 1:NP_523526.1 Gene:Trx-2 / 34281 FlyBaseID:FBgn0040070 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_593852.1 Gene:trx1 / 2542084 PomBaseID:SPAC7D4.07c Length:103 Species:Schizosaccharomyces pombe


Alignment Length:106 Identity:51/106 - (48%)
Similarity:68/106 - (64%) Gaps:3/106 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVYQVKDKADLDGQLTKASGKLVVLDFFATWCGPCKMISPKLVELSTQFADNVVVLKVDVDECED 65
            ||.||.|.::....:  ...||||:|||||||||||.|:||..:.|..::| ...:|||||:..:
pombe     1 MVKQVSDSSEFKSIV--CQDKLVVVDFFATWCGPCKAIAPKFEQFSNTYSD-ATFIKVDVDQLSE 62

  Fly    66 IAMEYNISSMPTFVFLKNGVKVEEFAGANAKRLEDVIKANI 106
            ||.|..:.:||:|...|||.|:||..|||..:||..||||:
pombe    63 IAAEAGVHAMPSFFLYKNGEKIEEIVGANPAKLEASIKANL 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trx-2NP_523526.1 TRX_family 18..103 CDD:239245 42/84 (50%)
trx1NP_593852.1 TRX_family 9..100 CDD:239245 42/93 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0907
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H128202
Inparanoid 1 1.050 101 1.000 Inparanoid score I1652
OMA 1 1.010 - - QHG54229
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 1 1.000 - - otm47166
orthoMCL 1 0.900 - - OOG6_100096
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1557
SonicParanoid 1 1.000 - - X356
TreeFam 1 0.960 - -
1211.760

Return to query results.
Submit another query.