DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trx-2 and txl1

DIOPT Version :9

Sequence 1:NP_523526.1 Gene:Trx-2 / 34281 FlyBaseID:FBgn0040070 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_595306.1 Gene:txl1 / 2541028 PomBaseID:SPBC577.08c Length:290 Species:Schizosaccharomyces pombe


Alignment Length:85 Identity:37/85 - (43%)
Similarity:54/85 - (63%) Gaps:2/85 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 SGKLVVLDFFATWCGPCKMISPKLVELSTQFAD-NVVVLKVDVDECEDIAMEYNISSMPTFVFLK 82
            ||.|.| |.:|.||||||.|||...:|::::|. ..|..||:|||...||....:.:||||||.:
pombe    19 SGYLAV-DCYADWCGPCKAISPLFSQLASKYASPKFVFAKVNVDEQRQIASGLGVKAMPTFVFFE 82

  Fly    83 NGVKVEEFAGANAKRLEDVI 102
            ||.:::...|||.:.|::.:
pombe    83 NGKQIDMLTGANPQALKEKV 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trx-2NP_523526.1 TRX_family 18..103 CDD:239245 37/85 (44%)
txl1NP_595306.1 TRX_family 10..103 CDD:239245 37/85 (44%)
PITH 129..275 CDD:283785
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100096
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1557
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.