DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trx-2 and ERP44

DIOPT Version :9

Sequence 1:NP_523526.1 Gene:Trx-2 / 34281 FlyBaseID:FBgn0040070 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_055866.1 Gene:ERP44 / 23071 HGNCID:18311 Length:406 Species:Homo sapiens


Alignment Length:105 Identity:35/105 - (33%)
Similarity:51/105 - (48%) Gaps:10/105 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DKADLDGQLTKASGKLVVLDFFATWCGPCKMISPKLVELSTQFAD------NVVVLKVDVDECED 65
            |..::|..|..|...||  :|:|.||...:|:.|...|.|....:      .||..:||.|:..|
Human    35 DTENIDEILNNADVALV--NFYADWCRFSQMLHPIFEEASDVIKEEFPNENQVVFARVDCDQHSD 97

  Fly    66 IAMEYNISSMPTFVFLKNGVKVE-EFAG-ANAKRLEDVIK 103
            ||..|.||..||....:||:.:: |:.| .:.|.|.|.|:
Human    98 IAQRYRISKYPTLKLFRNGMMMKREYRGQRSVKALADYIR 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trx-2NP_523526.1 TRX_family 18..103 CDD:239245 31/92 (34%)
ERP44NP_055866.1 PDI_a_ERp44 29..136 CDD:239294 34/102 (33%)
PDI_b_ERp44 144..234 CDD:239368
Interaction with ITPR1. /evidence=ECO:0000250 236..285
PDI_b'_ERp44 245..355 CDD:239370
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 360..387
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 403..406
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.