DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trx-2 and trx-4

DIOPT Version :9

Sequence 1:NP_523526.1 Gene:Trx-2 / 34281 FlyBaseID:FBgn0040070 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_491142.1 Gene:trx-4 / 189905 WormBaseID:WBGene00021548 Length:107 Species:Caenorhabditis elegans


Alignment Length:104 Identity:42/104 - (40%)
Similarity:70/104 - (67%) Gaps:0/104 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVYQVKDKADLDGQLTKASGKLVVLDFFATWCGPCKMISPKLVELSTQFADNVVVLKVDVDECED 65
            |...:||..:......:...:.|:|.|.|:|||||:||.|::.||:.:..|.:.:||:|||||:.
 Worm     1 MSIAIKDDDEFKTIFAEKKTQPVILFFTASWCGPCQMIKPRVEELAAEHKDRLSILKIDVDECDG 65

  Fly    66 IAMEYNISSMPTFVFLKNGVKVEEFAGANAKRLEDVIKA 104
            :..||.|:|||||:.:.:|:|.::|:|||..:.|:::||
 Worm    66 VGEEYEINSMPTFLLIVDGIKKDQFSGANNTKFEEMVKA 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trx-2NP_523526.1 TRX_family 18..103 CDD:239245 37/84 (44%)
trx-4NP_491142.1 TRX_family 9..103 CDD:239245 37/93 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157680
Domainoid 1 1.000 96 1.000 Domainoid score I4593
eggNOG 1 0.900 - - E2759_KOG0907
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I3585
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54229
OrthoDB 1 1.010 - - D1482186at2759
OrthoFinder 1 1.000 - - FOG0000170
OrthoInspector 1 1.000 - - otm14658
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.770

Return to query results.
Submit another query.