DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trx-2 and Y49E10.4

DIOPT Version :9

Sequence 1:NP_523526.1 Gene:Trx-2 / 34281 FlyBaseID:FBgn0040070 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_499613.1 Gene:Y49E10.4 / 176664 WormBaseID:WBGene00013030 Length:436 Species:Caenorhabditis elegans


Alignment Length:111 Identity:27/111 - (24%)
Similarity:45/111 - (40%) Gaps:22/111 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QVKDKADLDGQLTKASGKLVVL------------------DFFATWCGPCKMISPKLVELSTQFA 50
            ::|.|:....:.:...||:|||                  :|||.|||.|:.:.|:..:.:.:..
 Worm   138 RLKGKSSEKSKKSDKKGKVVVLTDSNFDKLVLNSKEPWMVEFFAPWCGHCQKLEPEWKKAAEEMG 202

  Fly    51 DNVVVLKVDVDECEDIAMEYNISSMPTFVFLKNGVK----VEEFAG 92
            ..|....:|....|.||.::.|...||..|...|..    .|::.|
 Worm   203 GRVKFGALDATAHESIAQKFGIRGFPTIKFFAPGTSSASDAEDYQG 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trx-2NP_523526.1 TRX_family 18..103 CDD:239245 25/97 (26%)
Y49E10.4NP_499613.1 PDI_a_P5 26..127 CDD:239299
PDI_a_P5 156..259 CDD:239299 23/93 (25%)
P5_C 269..405 CDD:239281
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.