DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trx-2 and W01B11.6

DIOPT Version :9

Sequence 1:NP_523526.1 Gene:Trx-2 / 34281 FlyBaseID:FBgn0040070 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_491139.1 Gene:W01B11.6 / 171903 WormBaseID:WBGene00020917 Length:109 Species:Caenorhabditis elegans


Alignment Length:104 Identity:22/104 - (21%)
Similarity:48/104 - (46%) Gaps:1/104 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVYQVKDKADLDGQLTKASGKLVVLDFFATWCGPCKMISPKLVELSTQFADNVVVLKVDVDECED 65
            :||......|...:.....||..:..|:...|..|:.|.|...:|..::....:|........:.
 Worm     2 VVYDCLTDEDFLQKSEHGIGKKAIYYFYGERCPSCESIKPLFDDLCKKYEKTALVYTYPCYNDDQ 66

  Fly    66 IAME-YNISSMPTFVFLKNGVKVEEFAGANAKRLEDVIK 103
            :..: :.::::||||.:.||.:|....||.|::::::.:
 Worm    67 LTGDAFAVNAVPTFVVMNNGEEVTRHVGAEAEKVQELFE 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trx-2NP_523526.1 TRX_family 18..103 CDD:239245 19/85 (22%)
W01B11.6NP_491139.1 TRX_family 21..105 CDD:239245 19/83 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.985475 Normalized mean entropy S646
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR10438
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.