DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trx-2 and Txndc5

DIOPT Version :9

Sequence 1:NP_523526.1 Gene:Trx-2 / 34281 FlyBaseID:FBgn0040070 Length:106 Species:Drosophila melanogaster
Sequence 2:NP_663342.3 Gene:Txndc5 / 105245 MGIID:2145316 Length:417 Species:Mus musculus


Alignment Length:85 Identity:23/85 - (27%)
Similarity:49/85 - (57%) Gaps:3/85 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 LDFFATWCGPCKMISP--KLVELSTQFADNVVVLKVDVDECEDIAMEYNISSMPTFVFLKNGVKV 87
            :.|||.|||.||.::|  :.:.|..:.::.|.:.|||..:...:..|:.:...||.::.::|.||
Mouse   196 IKFFAPWCGHCKALAPTWEQLALGLEHSETVKIGKVDCTQHYAVCSEHQVRGYPTLLWFRDGKKV 260

  Fly    88 EEFAG-ANAKRLEDVIKANI 106
            :::.| .:.:.|.|.:::.:
Mouse   261 DQYKGKRDLESLRDYVQSQL 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trx-2NP_523526.1 TRX_family 18..103 CDD:239245 23/80 (29%)
Txndc5NP_663342.3 PDI_a_ERp46 47..150 CDD:239303
ER_PDI_fam 52..417 CDD:273457 23/85 (27%)
PDI_a_ERp46 176..276 CDD:239303 23/79 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 281..302 23/85 (27%)
PDI_a_ERp46 308..409 CDD:239303
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 414..417
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.