DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4382 and NLGN2

DIOPT Version :9

Sequence 1:NP_609301.2 Gene:CG4382 / 34279 FlyBaseID:FBgn0032132 Length:580 Species:Drosophila melanogaster
Sequence 2:NP_065846.1 Gene:NLGN2 / 57555 HGNCID:14290 Length:835 Species:Homo sapiens


Alignment Length:664 Identity:189/664 - (28%)
Similarity:281/664 - (42%) Gaps:152/664 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MWRLCGFVLLLCGLASGQNSDEDLSKAIPDEEDPIGSNKELSDL------VITTALGKIRGT--I 57
            ||.|   .|.|.|||..|.....     |....|.|....|..|      |:.||.|::||.  .
Human     1 MWLL---ALCLVGLAGAQRGGGG-----PGGGAPGGPGLGLGSLGEERFPVVNTAYGRVRGVRRE 57

  Fly    58 LPSQSGRNFYAFRGIPYAKPPVDRLRFQPPEPVEQWFDTLDATFDGPKCPQ-----LGLVSGDV- 116
            |.::.......|.|:|||.||:...||||||....|....:||...|.|||     |..:...| 
Human    58 LNNEILGPVVQFLGVPYATPPLGARRFQPPEAPASWPGVRNATTLPPACPQNLHGALPAIMLPVW 122

  Fly   117 ---------------SEDCLRVNIYTKELPSESQP---------------NVR----RPVIVFIH 147
                           |||||.:|:|   :|:|..|               ::|    :||::|:|
Human   123 FTDNLEAAATYVQNQSEDCLYLNLY---VPTEDGPLTKKRDEATLNPPDTDIRDPGKKPVMLFLH 184

  Fly   148 PGGFYSLSGQSKNFAGPQYFMNRRLVLVTFNYRLGSLGFLATGTREAPGNMGLKDQVQLLRWVKL 212
             ||.| :.|....|.|........:::.|.|||||.||||:||.:.|.||.||.||:|.|||:..
Human   185 -GGSY-MEGTGNMFDGSVLAAYGNVIVATLNYRLGVLGFLSTGDQAAKGNYGLLDQIQALRWLSE 247

  Fly   213 HISRFGGDPSSITLLGYGAGAMAVTLHMVSPMSRGLFHKAIVMSGAVTGQWSLPDHQMDVATKQA 277
            :|:.|||||..||:.|.||||..|.|.::|..|.|||.|||..||.....||:....:......|
Human   248 NIAHFGGDPERITIFGSGAGASCVNLLILSHHSEGLFQKAIAQSGTAISSWSVNYQPLKYTRLLA 312

  Fly   278 TLLHCHTENVTEMMDCLKGKHYLEFA--NTLPKMFEFDRNNPLILWKPVIEPDFGQERFLVEEPI 340
            ..:.|..|:..|.::||:.|...|..  :..|..:.       |.:.||::.|     .:.::|.
Human   313 AKVGCDREDSAEAVECLRRKPSRELVDQDVQPARYH-------IAFGPVVDGD-----VVPDDPE 365

  Fly   341 RSYQNDDFMKVPIITGMTKDEFVGPALSILQSPTLLSALNENFESLAPVFFMYNTSDARACNISQ 405
            ...|..:|:...::.|:.:    |..|..::.    ||.:|:..|.:...|          .:|.
Human   366 ILMQQGEFLNYDMLIGVNQ----GEGLKFVED----SAESEDGVSASAFDF----------TVSN 412

  Fly   406 ELRNHY-FPDKLIDANRSLEALSNLYSD-------------ALTGFGIHRFVHLAARSTK----- 451
            .:.|.| :|:.. |..|  |.:..:|:|             .|..|..|::|..|..:.|     
Human   413 FVDNLYGYPEGK-DVLR--ETIKFMYTDWADRDNGEMRRKTLLALFTDHQWVAPAVATAKLHADY 474

  Fly   452 ---VYYYRFSY----QGARSHIYYPE--DAPYGVVHHDDLMYLFVEPSISRM------FTEDDDE 501
               ||:|.|.:    :|.      ||  ||.:|    |:|.|:|..|.:...      |:::|  
Human   475 QSPVYFYTFYHHCQAEGR------PEWADAAHG----DELPYVFGVPMVGATDLFPCNFSKND-- 527

  Fly   502 FRMVDIMVRMFSAFAYKGDPNKPTDL----------ALRDIRWRPFSFKKRYYLDIGKHITLEEN 556
            ..:..:::..::.||..||||:|...          ...::.|..|:.|::.||.||....:.:|
Human   528 VMLSAVVMTYWTNFAKTGDPNQPVPQDTKFIHTKPNRFEEVVWSKFNSKEKQYLHIGLKPRVRDN 592

  Fly   557 LNAENYEIWKRLFP 570
            ..|.....|..|.|
Human   593 YRANKVAFWLELVP 606

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4382NP_609301.2 COesterase 41..565 CDD:278561 174/617 (28%)
NLGN2NP_065846.1 COesterase 41..601 CDD:278561 172/609 (28%)
Aes <170..>268 CDD:223730 45/99 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 623..668
Required for interaction with LHFPL4. /evidence=ECO:0000250|UniProtKB:Q69ZK9 678..698
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 790..835
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142793
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.