DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4382 and si:dkey-193c22.1

DIOPT Version :9

Sequence 1:NP_609301.2 Gene:CG4382 / 34279 FlyBaseID:FBgn0032132 Length:580 Species:Drosophila melanogaster
Sequence 2:NP_001093504.1 Gene:si:dkey-193c22.1 / 567837 ZFINID:ZDB-GENE-030131-7957 Length:370 Species:Danio rerio


Alignment Length:283 Identity:64/283 - (22%)
Similarity:115/283 - (40%) Gaps:56/283 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 ELPSESQPNVRRPVIVFIHPGGFYSLSGQSKNFAGPQYFMNRRL--VLVTFNYRLGSLGFLATGT 191
            ||..||..    ||:||:: ||.:. ||....:......|.:.|  .::..:|.:...|.:.   
Zfish   111 ELSDESPV----PVVVFVY-GGAWG-SGDRSIYCLLALQMAKELNASVICPDYSIYPKGNVL--- 166

  Fly   192 REAPGNMGLKDQVQLLRWVKLHISRFGGDPSSITLLGYGAGAMAVTLHMVSPMSRGLFHKAIVMS 256
                 || ::|....|.||:.....|..|..:|.|:|:.|||     |:.:..|       :.::
Zfish   167 -----NM-VQDISDSLLWVRQKGHAFSLDQDNIILIGHSAGA-----HLCALTS-------LFLA 213

  Fly   257 GAVTGQWSLPDHQMDVATKQATLLHCHTENVTEMMDCLKGKHY-------LEFANTLPKMFE--- 311
            ..|...:...:.|.|:.|....::  ....|..:||     ||       :|:.:|:.|..:   
Zfish   214 SNVEELFIETNKQKDLVTAIKGII--GLSGVYSIMD-----HYNHEKVRAVEYVSTMHKAMDGVE 271

  Fly   312 -FDRNNPLILWKPVIEPDFGQERFLVEEPIRSYQNDDFMKVPIITGMTKDEFVGPALSILQSPTL 375
             ||..:|..|.|.:.|     ::.....|:..:...:.:.||:.:.:...|.: .:|||..|..|
Zfish   272 NFDYYSPTSLLKKMKE-----DQLKRVPPMALFHGTNDIIVPVESSVRFSELL-TSLSIRMSLYL 330

  Fly   376 LSALNEN---FESLAPVFFMYNT 395
            :..:|..   .:.:||....|:|
Zfish   331 IPKMNHTDMVTDLMAPDRHFYHT 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4382NP_609301.2 COesterase 41..565 CDD:278561 64/283 (23%)
si:dkey-193c22.1NP_001093504.1 Aes 87..336 CDD:223730 59/264 (22%)
Abhydrolase 121..>210 CDD:304388 26/111 (23%)
Abhydrolase 167..336 CDD:304388 43/194 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.