DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4382 and Nlg4

DIOPT Version :9

Sequence 1:NP_609301.2 Gene:CG4382 / 34279 FlyBaseID:FBgn0032132 Length:580 Species:Drosophila melanogaster
Sequence 2:NP_001369025.1 Gene:Nlg4 / 42402 FlyBaseID:FBgn0083975 Length:1437 Species:Drosophila melanogaster


Alignment Length:689 Identity:176/689 - (25%)
Similarity:265/689 - (38%) Gaps:200/689 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 LSDLVITTALGKIRGTILPSQSG---RNFYAFRGIPYAKPPVDRLRFQPPEPVEQWFDTLDATFD 102
            |...::.|..|::.|.|||..|.   |:...|.|:|||.||..:.||.|......|        |
  Fly    39 LGHRIVQTRYGRLHGLILPLDSFRFLRSVEVFLGVPYATPPTKQNRFSPTRAPAPW--------D 95

  Fly   103 G--------PKCPQ-LGLVSGDV------------------------SEDCLRVNIYTKELPSES 134
            |        |.||| |..:..:.                        |||||.:|:::   |..:
  Fly    96 GIRISDKYSPVCPQRLPNIQNETAALEKMPKGRLEYLKRLLPFLENQSEDCLYLNVFS---PVNA 157

  Fly   135 QPNVRR-PVIVFIHPGGFYSLSGQSKNFAGPQYFMNRRLVLVTFNYRLGSLGFLATG----TREA 194
            ..|.:: |||||||...|...||..  :.|........:|:||.|||||.||||...    ....
  Fly   158 GANEKKLPVIVFIHGESFEWSSGNP--YDGSVLASYGEVVVVTLNYRLGILGFLNANPNPHAHAR 220

  Fly   195 PGNMGLKDQVQLLRWVKLHISRFGGDPSSITLLGYGAGAMAVTLHMVSP-MSRGLFHKAIVMSGA 258
            ..|.||.||:..|.|::.:|.:|||||:|:||.|:|.||..:...|.|| |.|||||:||:|||:
  Fly   221 VANYGLMDQMAALHWIQQNIQKFGGDPNSVTLAGHGTGAACINYLMTSPTMVRGLFHRAILMSGS 285

  Fly   259 VTGQWSLPDHQMDVATKQATLLHC--------HTENVTEMMDCLKGKHYLEFANTLPKMFEFDRN 315
            ....|:|.:..:..|.|.|..::|        |.|   :::|||:..       .|..::..|..
  Fly   286 AYSSWALVEDPVLFAIKLAKEVNCTIPDDINRHHE---QIVDCLRDV-------PLEDLYLADIQ 340

  Fly   316 NP--LILWKP-----VIEPDFGQ---ERFLVEEPIRSYQNDDFMK-------------------- 350
            .|  |..:.|     ||.|....   :..:.....||..:..|..                    
  Fly   341 APNFLTSFGPSVDGVVIRPGHSNLDIDDLMARNSRRSSADSGFQSSAGGGGGQGGGAGGGGGGGS 405

  Fly   351 --------------------------VPIITGMT---------KDEFVGPALSILQSPTLLSA-- 378
                                      ..::||.:         ::.|.|.....:....:.:|  
  Fly   406 GSSFGGGYFGGSGAGTMNMGGHYDVLFGVVTGESIWRFSAHDIQNGFEGERRDKIIRTYVRNAYN 470

  Fly   379 --LNENFESLA------------PVFFMYNTSDARACNISQELRNHYFPDKLIDANRSLEALS-- 427
              |||.|.::.            |:    ||.|.....:|    :..|...::.|...|.|.|  
  Fly   471 YHLNEIFYTIVNEYTDWDRTSQHPI----NTRDTAVAALS----DAQFVAPIVRAGDILAANSPP 527

  Fly   428 NLYSDALTGF-GIHRFVHLAARST----KVYYYRFSYQGARSHIYYPEDAPY----GVVHHDDLM 483
            .:.|.:..|. |.:.....:|.||    :.|:|.|.||        .:|..|    |.||.:||.
  Fly   528 PVSSSSTAGSPGANAAASTSAGSTQPSGRCYFYVFDYQ--------TKDGDYPQRMGTVHGEDLP 584

  Fly   484 YLFVEPSIS------RMFTEDDDEFRMVDIMVRMFSAFAYKGDPNK--PTDLAL---------RD 531
            |:|..|.:.      :.:|:  .|..:.:.::..::.||..|:||:  ..|.:|         |.
  Fly   585 YIFGAPLVDGFSHFPQNYTK--SETALSEAVMIFWTNFARTGNPNEHHRQDSSLPVSKERNRFRS 647

  Fly   532 IRWRPFSFKKRYYLDIGKHITLEENLNAENYEIWKRLFP 570
            |.|..:....:.||:||....::.:..|....||.||.|
  Fly   648 ITWENYDPLHQKYLEIGMKPRIKNHFRAHQLSIWLRLIP 686

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4382NP_609301.2 COesterase 41..565 CDD:278561 171/682 (25%)
Nlg4NP_001369025.1 COesterase 43..681 CDD:395084 170/678 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46967
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.