DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4382 and alpha-Est7

DIOPT Version :9

Sequence 1:NP_609301.2 Gene:CG4382 / 34279 FlyBaseID:FBgn0032132 Length:580 Species:Drosophila melanogaster
Sequence 2:NP_524261.1 Gene:alpha-Est7 / 40901 FlyBaseID:FBgn0015575 Length:572 Species:Drosophila melanogaster


Alignment Length:567 Identity:157/567 - (27%)
Similarity:257/567 - (45%) Gaps:70/567 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 LVITTALGKIRGTILPSQSGRNFYAFRGIPYAKPPVDRLRFQPPEPVEQWFDTLDATFDGPKCPQ 108
            :|..|..|::||....|.....:::|.|||||:|||..|||:.|:....|....|.:....|..|
  Fly    33 VVADTEYGQVRGIKRLSLYDVPYFSFEGIPYAQPPVGELRFKAPQRPIPWERVRDCSQPKDKAVQ 97

  Fly   109 LGLVSGDV--SEDCLRVNIYTKELPSESQPNVRRPVIVFIHPGGFYSLSGQSKNFAGPQYFMNRR 171
            :..|...|  |||||.:|:||..:    :|:..|||:|:||.|||. :...::.:.||.|||...
  Fly    98 VQFVFDKVEGSEDCLYLNVYTNNV----KPDKARPVMVWIHGGGFI-IGEANREWYGPDYFMKED 157

  Fly   172 LVLVTFNYRLGSLGFLATGTRE--APGNMGLKDQVQLLRWVKLHISRFGGDPSSITLLGYGAGAM 234
            :||||..||||:|||::..:.|  .|||.||||||..|:|:|.:.:.|||||:.||:.|..||..
  Fly   158 VVLVTIQYRLGALGFMSLKSPELNVPGNAGLKDQVLALKWIKNNCASFGGDPNCITVFGESAGGA 222

  Fly   235 AVTLHMVSPMSRGLFHKAIVMSGAVTGQWSLPDHQMDVATKQATLLHC-------HTENVTEMMD 292
            :....|::..::||||:.|:.||:....|:   :..|:......:...       :.::|.|.:.
  Fly   223 STHYMMLTDQTQGLFHRGILQSGSAICPWA---YNGDITHNPYRIAKLVGYKGEDNDKDVLEFLQ 284

  Fly   293 CLKGKHYLEFANTLPKMFEFDRNNPLILWKPVIEPDFGQERFLVEEPIRSYQNDDFMK------V 351
            .:|.|..:.....:..: |...|..:..:.|.:|| |.....::.:|.:     :.||      :
  Fly   285 NVKAKDLIRVEENVLTL-EERMNKIMFAFGPSLEP-FSTPECVISKPPK-----EMMKTAWSNSI 342

  Fly   352 PIITGMTKDEFVGPALSILQSPTLLSALNENFESLAPVFFMYNTSDARACNISQELRNHY----- 411
            |:..|.|..|.:.....:...|.:|..|:.....:.........|..:..:.|.::|:.:     
  Fly   343 PMFIGNTSYEGLLWVPEVKLMPQVLQQLDAGTPFIPKELLATEPSKEKLDSWSAQIRDVHRTGSE 407

  Fly   412 -FPDKLIDANRSLEALSNLYSDALTGFGIHRFVHLAARSTKVYYYRFSYQGARSHIYYPEDAPY- 474
             .||..:|       |.::|........:....|..|....||:||:.:. :...|:     || 
  Fly   408 STPDNYMD-------LCSIYYFVFPALRVVHSRHAYAAGAPVYFYRYDFD-SEELIF-----PYR 459

  Fly   475 ---------GVVHHDDLMYLFVEPSISRMFTEDDDEFRMVDIMVRMFSAFAYKGDP-----NKPT 525
                     ||.|.|||.|.| ...::|...::..|:|.::..|.:::.||..|:|     |...
  Fly   460 IMRLGRGVKGVSHADDLSYQF-SSLLARRLPKESREYRNIERTVGIWTQFAATGNPYSEKINGMD 523

  Fly   526 DLALRDIRWRPFSFKKRYYLDIGKHITLEENLNAENYEIWKRLFPLN 572
            .|.:..:|......|.....|..|.|.|.|   ....::|:.|:..|
  Fly   524 TLTIDPVRKSDEVIKCLNISDDLKFIDLPE---WPKLKVWESLYDDN 567

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4382NP_609301.2 COesterase 41..565 CDD:278561 154/558 (28%)
alpha-Est7NP_524261.1 COesterase 27..514 CDD:278561 144/509 (28%)
Aes <116..>221 CDD:223730 50/109 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467406
Domainoid 1 1.000 98 1.000 Domainoid score I1867
eggNOG 1 0.900 - - E2759_KOG1516
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I1664
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D206516at33208
OrthoFinder 1 1.000 - - FOG0000017
OrthoInspector 1 1.000 - - otm46967
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X33
98.800

Return to query results.
Submit another query.