DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4382 and gas

DIOPT Version :9

Sequence 1:NP_609301.2 Gene:CG4382 / 34279 FlyBaseID:FBgn0032132 Length:580 Species:Drosophila melanogaster
Sequence 2:NP_611678.1 Gene:gas / 37572 FlyBaseID:FBgn0034736 Length:566 Species:Drosophila melanogaster


Alignment Length:543 Identity:171/543 - (31%)
Similarity:258/543 - (47%) Gaps:88/543 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 GSNKELSDLVITTALGKIRG----TILPSQSGRNFYAFRGIPYAKPPVDRLRFQPPEPVEQWFDT 96
            |..|||:     |..|:::|    |:   ..|..:|:|.|||:|:|||..|||:.|:|...|...
  Fly    30 GQTKELA-----TKYGQLKGQQRRTL---YDGEPYYSFEGIPFAQPPVGELRFRAPQPPSSWQGV 86

  Fly    97 LDATFDGPKCPQLGLV--SGDVSEDCLRVNIYTKELPSESQPNVRRPVIVFIHPGGFYSLSGQSK 159
            .|.|:...|..|...:  :.:.|||||.:|:|.|.|.|...    .||:|:|..||| .:.|.|:
  Fly    87 RDCTYAREKPMQRNSITNAAEGSEDCLYLNVYAKRLESPKP----LPVMVWIFGGGF-QVGGASR 146

  Fly   160 NFAGPQYFMNRRLVLVTFNYRLGSLGFLATGTRE--APGNMGLKDQVQLLRWVKLHISRFGGDPS 222
            ...||.|||...::|||.|||:|.||||:...:|  .|||.|||||:|.|||||.:|:.|.|||.
  Fly   147 ELYGPDYFMKHDILLVTINYRVGVLGFLSLKDKELKIPGNAGLKDQIQALRWVKENIASFNGDPE 211

  Fly   223 SITLLGYGAGAMAVTLHMVSPMSRGLFHKAIVMSGAVTGQWSL-PDHQMDVATKQATLLHCHTEN 286
            |||:.|..||..:..:.|.:..:|||||:|||.||:....|:. ||.:......:......:.|:
  Fly   212 SITVFGESAGGASTHILMQTEQARGLFHRAIVQSGSALCAWATQPDRKWPQRLGKELGYAGNLES 276

  Fly   287 VTEMMDCLKGKHYLEFANTLP--KMFEF---------DRNNPLILWKPVIEPDFGQERFLVEEPI 340
            ..|:         |||...:|  |:.::         .|:..::.:.|||||..|.:..:.:...
  Fly   277 EKEL---------LEFFQQIPASKLAQYCNSIVTQEEQRDYEILAFAPVIEPYVGDDCVIPKSQQ 332

  Fly   341 RSYQNDDFMKVPIITGMTKDEFVGPALSILQSPT-LLSALNENFESLAPVFFMYNTSDARACNIS 404
            ....:.....:|:|.|.|..|.:....:.|..|. :|||    ||::.|..............:.
  Fly   333 EQLSSAWGNSIPMIIGGTSFEGLFSYRTTLDDPLYMLSA----FEAIIPKQVRDAIDKEELAEMV 393

  Fly   405 QELRNHYF--PDKLIDANRSLEALSNLYSDALTGF--GIHR--FVHLA-ARSTKVYYYRFSYQGA 462
            :.|:..||  ||:     .|:|....|:..::..|  .|||  ...|| |.:...|.|||..   
  Fly   394 RRLKKSYFDDPDR-----ASMELYECLHILSIKNFWHDIHRTLLARLAYATNLPTYLYRFDM--- 450

  Fly   463 RSHIYYPEDAPY--------------GVVHHDDLMYLFVEPSISRMFTEDDDEFRMVDIMVRMFS 513
                    |:|:              ||.|.||:.|:|. ..:|....::..|:|.::.:|.|::
  Fly   451 --------DSPHFNHYRILKCGKKVRGVCHADDISYMFY-GILSSKLDKNSPEYRTIERLVGMWT 506

  Fly   514 AFAYKGDPNKPTDLALRDIRWRP 536
            :||..||||..   .:..::|.|
  Fly   507 SFATTGDPNCE---IIAPVKWDP 526

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4382NP_609301.2 COesterase 41..565 CDD:278561 168/538 (31%)
gasNP_611678.1 COesterase 28..534 CDD:278561 171/543 (31%)
Aes <117..>222 CDD:223730 54/109 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467394
Domainoid 1 1.000 98 1.000 Domainoid score I1867
eggNOG 1 0.900 - - E2759_KOG1516
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I1664
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D206516at33208
OrthoFinder 1 1.000 - - FOG0000017
OrthoInspector 1 1.000 - - otm46967
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X33
98.800

Return to query results.
Submit another query.