DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4382 and CG12869

DIOPT Version :9

Sequence 1:NP_609301.2 Gene:CG4382 / 34279 FlyBaseID:FBgn0032132 Length:580 Species:Drosophila melanogaster
Sequence 2:NP_001369085.1 Gene:CG12869 / 36616 FlyBaseID:FBgn0033943 Length:839 Species:Drosophila melanogaster


Alignment Length:573 Identity:146/573 - (25%)
Similarity:234/573 - (40%) Gaps:122/573 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 ILPSQSGRNFYAFRGIPYAKPPVDRLRFQPPEPVEQWFDTLDATFDGPKCPQL----------GL 111
            :.|..:....|||.|||||:.|::.|||.|.:|...:..||.||...|.||||          |.
  Fly    43 VFPDGTRGAVYAFLGIPYAQAPINELRFAPAKPSSSFNRTLQATTMQPLCPQLANTIYDESSDGS 107

  Fly   112 VSGDVS--EDCLRVNIYTKELPSESQPNVRRPVIVFIHPGGFYSLSGQSKNFAGPQYFMN----- 169
            :...||  ||||.:||:|   |.......:.|::|.:        :|:...:..|:..:|     
  Fly   108 MPRSVSTDEDCLYLNIWT---PESGMRYGKLPIVVIV--------TGEEFAYDWPRNRINGLDLA 161

  Fly   170 -RRLVLVTFNYRLGSLGFLATGT--REAPGNMGLKDQVQLLRWVKLHISRFGGDPSSITLLGYGA 231
             ..:|:|:..||....|:|:.|.  |..|||.||.|....|||::.:...|||:|..|||||:|:
  Fly   162 GEGIVVVSVQYRNNIYGWLSLGEQHRNVPGNYGLSDVQMALRWIRRNADAFGGNPDHITLLGHGS 226

  Fly   232 G----AMAVTLHMVSP------MSRGLFHKAIVMSGAVTGQWSLPDHQ-MDVATKQATL--LHCH 283
            |    |:..||...|.      ||.|...:|:       ||    :|| ..|.|.|..:  |.|.
  Fly   227 GGAPLALVATLEDSSQVKQLVLMSPGPIMRAL-------GQ----NHQKWIVETGQVLVQKLGCQ 280

  Fly   284 TENV--TEMMDCLKGKHYLEFANTLPKMFEFDRNNPLILWKPVIEPDFGQERFLVEEPIRSYQND 346
            .|..  .::|.||:.|...:.......::.....:..:   .||.|    |...:|:.:|:    
  Fly   281 FEEAQRRQLMGCLRRKSREDLLRAYESVYNHGNGSSQL---GVILP----EGLPLEQRLRN---- 334

  Fly   347 DFMKV--PIITGMTKDE--FVGP-----------ALSILQSPTLLSALNENFESLAPVFFMYNTS 396
               |.  |::.|:|.:|  |:..           ||....:.|||..:....||:..     .:|
  Fly   335 ---KTLPPVLLGITSNEGAFLQDYWLDVAREGQVALHKYINHTLLPNVMRALESVGE-----ESS 391

  Fly   397 DARACNISQELRNHYFPDKLIDANRSLEALSNLYSDALTGFGIHRFVHLAARSTKVYYYRFSY-- 459
            ...|.     :|..||..|....:..|..:..|.|::|......|.:.| ...|..|.|.|.:  
  Fly   392 TQLAA-----IRWRYFNGKGEGVSHLLAGMQRLLSESLYELPYSRILEL-LNGTTSYAYVFDHSH 450

  Fly   460 ----QGARSHIYYPEDAPYGVVHHDDLMYLFVEPSI-----SRMFTEDDDEFRMVDIMVRMFSAF 515
                :|.|:        .:|...|...:.|.:.||:     .|.|:.::::     :..::..||
  Fly   451 SMDMRGRRN--------LFGGASHSSDLPLLLGPSLFQQIARRRFSGEEEQ-----LCRKIRGAF 502

  Fly   516 AYKGDPNKPTDLALRDIRWRPFSFKKRYYLDIGKHITLEENLNAENYEIWKRL 568
            |.......||...:.| .|.|::.:..:...:|:.....:..:.:..|:.|.|
  Fly   503 ANFIKNGNPTPGRIYD-GWLPYNKENPFVYSLGEQAKTPQTGSVDEAEVDKLL 554

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4382NP_609301.2 COesterase 41..565 CDD:278561 144/568 (25%)
CG12869NP_001369085.1 COesterase 27..541 CDD:395084 143/558 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11559
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.