DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4382 and Nlg2

DIOPT Version :9

Sequence 1:NP_609301.2 Gene:CG4382 / 34279 FlyBaseID:FBgn0032132 Length:580 Species:Drosophila melanogaster
Sequence 2:NP_001245916.1 Gene:Nlg2 / 33962 FlyBaseID:FBgn0031866 Length:1248 Species:Drosophila melanogaster


Alignment Length:595 Identity:165/595 - (27%)
Similarity:246/595 - (41%) Gaps:113/595 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 GSNKELSDLVITTALGKIRGTILPSQSGRNFYAFRGIPYAKPPVDRLRFQPPEPVEQWFDTLDAT 100
            |||      .:.|..|.:||.::  :|.....||.|||||.|||..|||.||.....|.....|.
  Fly   181 GSN------TVKTKYGLLRGIVV--RSSPLVEAFLGIPYASPPVGSLRFMPPITPSTWKTVRSAD 237

  Fly   101 FDGPKCPQ--------------------------LGLVSGDVSEDCLRVNIYTKELPSES----- 134
            ...|.|||                          |.|:... |||||.:|||   :|.|:     
  Fly   238 RFSPVCPQNIPIPPNGPEALLEVPRARLAQLRRLLPLLKNQ-SEDCLYLNIY---VPYETRRQRR 298

  Fly   135 -------QPNVRRPVIVFIHPGGFYSLSGQSKNFAGPQYFMNRRLVLVTFNYRLGSLGFLATGTR 192
                   :|..:...:||||...:...||..  :.|.:...:..:::||.|:|||..|||.||.:
  Fly   299 NTDDTTGEPKTKLSTVVFIHGESYDWNSGNP--YDGSELAAHGNVIVVTINFRLGIFGFLKTGGK 361

  Fly   193 E-APGNMGLKDQVQLLRWVKLHISRFGGDPSSITLLGYGAGAMAVTLHMVSPMSRGLFHKAIVMS 256
            | |.||.||.|.|..|.|:|.::..|||||.||||||||.||:...:.:|||::..|..:.:::|
  Fly   362 ESAQGNFGLMDLVAGLHWLKENLPAFGGDPQSITLLGYGTGAVLANILVVSPVASDLIQRTVLVS 426

  Fly   257 GAVTGQWSLPDHQMDVATKQATLLHCHTENV-TEMMDCLKGKHYLEFANTLPKMFEFDRNNPLIL 320
            |:....|::..:.:.|..:.|....||.:.: .::..||:.|...|..     ..:.|....|:.
  Fly   427 GSALSPWAIQKNPLFVKRRVAEQTGCHGDMLYDDLAPCLRTKSVAELL-----AVKVDHPRFLVG 486

  Fly   321 WKP-----VIEP---DFGQERFLVEEPIRS-----YQNDDFMKVPIITGMTKDEFVGPALSILQS 372
            :.|     ||.|   ..|.....:...|.|     |.|  |.|..:|..:|..|    :...|.:
  Fly   487 FAPFVDGTVISPGANPLGSTTLPLGSAIVSTSGIEYAN--FPKRDLIFCLTSVE----SYLDLSA 545

  Fly   373 PTLLSALNENFESLAPVFFMYNTSDARACNISQELRNHYFP-DKLI-DANRSLEALSNLYSDALT 435
            ..|....||.........|:.|........|...|:|.|.. :|.| :...|.:|.....||..|
  Fly   546 QDLEFGFNETRRDRILRTFVRNNFHYHLNEIFAVLKNEYTDWEKAIRNPLSSRDATLQFLSDGHT 610

  Fly   436 GFGIHR--FVHLAARSTKVYYYRFSYQGARSHIYYPEDAPYGVVHHDDLMY---LFVEPSISRMF 495
            ...:.:  ::| :.|..:.|:..|.::.....  ||:.:  |.|..:|:.:   |.:.|.....:
  Fly   611 ASPLIKLGYMH-SLRGGRAYFLHFKHKTIEEE--YPQRS--GSVRGEDVPFWLGLPMSPLFPHNY 670

  Fly   496 TEDDDEFRMVDIMVRMFSAFAYKGDPNKPT------------DLALRDIRWRPFSFKKRYYLDIG 548
            |  ..|.::..:|:|..|.||..|:||:.|            :.||...:.|..|.         
  Fly   671 T--TQERQIGRLMLRYLSNFAKTGNPNQSTAKSVLPNPNEVLETALHQQKKRSTSL--------- 724

  Fly   549 KHITLEENLN 558
            .|..|.|.||
  Fly   725 THPNLSEALN 734

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4382NP_609301.2 COesterase 41..565 CDD:278561 162/590 (27%)
Nlg2NP_001245916.1 COesterase 182..712 CDD:278561 155/561 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.