DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4382 and Cel

DIOPT Version :9

Sequence 1:NP_609301.2 Gene:CG4382 / 34279 FlyBaseID:FBgn0032132 Length:580 Species:Drosophila melanogaster
Sequence 2:NP_034015.1 Gene:Cel / 12613 MGIID:88374 Length:599 Species:Mus musculus


Alignment Length:581 Identity:176/581 - (30%)
Similarity:259/581 - (44%) Gaps:116/581 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 GSNKELSDLVITTALGKIRGTILPSQSGRNFYAFRGIPYAKPPVDRLRFQPPEPVEQWFDTLDAT 100
            |.||:||.|                 .|.:...|:|||:|....    .:.|:....|..||.||
Mouse    35 GVNKKLSLL-----------------GGDSVDIFKGIPFATAKT----LENPQRHPGWQGTLKAT 78

  Fly   101 FDGPKCPQLGLVSGDV--SEDCLRVNIYTKELPSESQPNVRRPVIVFIHPGGFYSLSGQSKNFA- 162
            ....:|.|..:...:.  .||||.:||:..:  ...|.:...||:|:|:.|.|...|||..||. 
Mouse    79 NFKKRCLQATITQDNTYGQEDCLYLNIWVPQ--GRKQVSHNLPVMVWIYGGAFLMGSGQGANFLK 141

  Fly   163 -----GPQYFMNRRLVLVTFNYRLGSLGFLATGTREAPGNMGLKDQVQLLRWVKLHISRFGGDPS 222
                 |.:......:::||||||:|.||||:||....|||.||:||...:.|||.:|:.|||||.
Mouse   142 NYLYDGEEIATRGNVIVVTFNYRVGPLGFLSTGDANLPGNFGLRDQHMAIAWVKRNIAAFGGDPD 206

  Fly   223 SITLLGYGAGAMAVTLHMVSPMSRGLFHKAIVMSGAVTGQWSLPDHQMDVATKQATLLHCHTENV 287
            :||:.|..|||.:|:|..:||.::||..:||..||.....|::..:.:..|...|..:.|.||:.
Mouse   207 NITIFGESAGAASVSLQTLSPYNKGLIRRAISQSGMALSPWAIQKNPLFWAKTIAKKVGCPTEDT 271

  Fly   288 TEMMDCLK--GKHYLEFANTLP-KMFEFDRNNPLI---LWKPVIEPDFGQERFLVEEPIRSYQND 346
            .:|..|||  ....|..|..|| |..|:    |::   .:.|||:.|     |:.::||..|.|.
Mouse   272 GKMAACLKITDPRALTLAYKLPVKKQEY----PVVHYLAFIPVIDGD-----FIPDDPINLYNNT 327

  Fly   347 DFMKVPIITGMTKDEFVGPALSILQSP----TLLSALNENFESLA-------------PVFFMYN 394
              ..:..|.|:...:  |...:.:..|    |..:...|:|..|.             ..|.:|.
Mouse   328 --ADIDYIAGINNMD--GHLFATIDVPAVDKTKQTVTEEDFYRLVSGHTVAKGLKGAQATFDIYT 388

  Fly   395 TSDARACNISQELRNHYFPDKLIDANRSLEALSNLYSDALTGFGIHRFVHLA-----ARSTKVYY 454
            .|.|:  :.|||           :..:::.|..   :|.|  |.|...:.||     |:|.|.|.
Mouse   389 ESWAQ--DPSQE-----------NMKKTVVAFE---TDVL--FLIPTEIALAQHKAHAKSAKTYS 435

  Fly   455 YRFSYQGARSHIYYPEDAP--YGVVHHDDLMYLFVEPSISRMFTEDDDEFRMVD-IMVRMFSAFA 516
            |.||:. :|..||     |  .|..|.|||.|:|.:|..:.:.....|  |.|. .|:..::.||
Mouse   436 YLFSHP-SRMPIY-----PKWMGADHADDLQYVFGKPFATPLGYRPQD--RAVSKAMIAYWTNFA 492

  Fly   517 YKGDPNK-----PTDLALRDIRWRPFSFKKRYYLDIGKHIT---LEENLNAENYEIWKRLF 569
            ..||||.     ||       .|.|::.:...||||.|.||   ::|:|..:..:.|...|
Mouse   493 RSGDPNMGNSPVPT-------HWYPYTLENGNYLDITKTITSASMKEHLREKFLKFWAVTF 546

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4382NP_609301.2 COesterase 41..565 CDD:278561 171/570 (30%)
CelNP_034015.1 COesterase 26..542 CDD:278561 174/575 (30%)
Aes <117..>247 CDD:223730 57/129 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 553..599
4 X 11 AA tandem repeats, O-glycosylated region 559..588
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167832814
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000017
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.