DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4382 and LOC107987423

DIOPT Version :9

Sequence 1:NP_609301.2 Gene:CG4382 / 34279 FlyBaseID:FBgn0032132 Length:580 Species:Drosophila melanogaster
Sequence 2:XP_016885725.1 Gene:LOC107987423 / 107987423 -ID:- Length:286 Species:Homo sapiens


Alignment Length:313 Identity:72/313 - (23%)
Similarity:125/313 - (39%) Gaps:76/313 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   290 MMDCLKGKHYLEFANTLPKM------FEFDRNNPLILWKPVIEPDFGQERFLVEEPIRSYQNDDF 348
            |:.||:.|...|...|..||      .:.|......|...||:   |.......|.:::.:|  |
Human     1 MVHCLRQKTEEELLETTLKMKFLSLDLQGDPRESQPLLGTVID---GMLLLKTPEELQAERN--F 60

  Fly   349 MKVPIITGMTKDEF--------VGPALS--ILQSPTLLSALNENFESLAPVFFMYNTSDARACNI 403
            ..||.:.|:.|.||        :...||  .|...|.:|.|.:::    |:          .| |
Human    61 HTVPYMVGINKQEFGWLIPMQLMSYPLSEGQLDQKTAMSLLWKSY----PL----------VC-I 110

  Fly   404 SQELRNHYFP---DKLI----DANRSLEALSNLYSDALTGFGIHRFVHLAARSTK-----VYYYR 456
            ::||    .|   :|.:    |..:..:...:|.:|.:  ||:...:  .||:.:     .|.|.
Human   111 AKEL----IPEATEKYLGGTDDTVKKKDLFLDLIADVM--FGVPSVI--VARNHRDAGAPTYMYE 167

  Fly   457 FSYQGARSHIYYPEDAPYGVV--HHDDLMYLFVEPSISRMFTEDDDEFRMVDIMVRMFSAFAYKG 519
            |.|:.:    :..:..|..|:  |.|:|..:|..|.:....:|  :|.|:..::::.::.||..|
Human   168 FQYRPS----FSSDMKPKTVIGDHGDELFSVFGAPFLKEGASE--EEIRLSKMVMKFWANFARNG 226

  Fly   520 DPN---KPTDLALRDIRWRPFSFKKRYYLDIGKHITLEENLNAENYEIWKRLF 569
            :||   .|        .|..:: :|..||.||.:....:.|..:....|..||
Human   227 NPNGEGLP--------HWPEYN-QKEGYLQIGANTQAAQKLKDKEVAFWTNLF 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4382NP_609301.2 COesterase 41..565 CDD:278561 69/307 (22%)
LOC107987423XP_016885725.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D206516at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.