DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3841 and NLGN2

DIOPT Version :9

Sequence 1:NP_001188759.1 Gene:CG3841 / 34278 FlyBaseID:FBgn0032131 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_065846.1 Gene:NLGN2 / 57555 HGNCID:14290 Length:835 Species:Homo sapiens


Alignment Length:650 Identity:176/650 - (27%)
Similarity:273/650 - (42%) Gaps:170/650 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 WALLLILIGFTTA------------------VTFIGDD--PVVELSLGRIQGDTMQSFGNK---T 50
            |.|.|.|:|...|                  :..:|::  |||..:.||::| ..:...|:   .
Human     2 WLLALCLVGLAGAQRGGGGPGGGAPGGPGLGLGSLGEERFPVVNTAYGRVRG-VRRELNNEILGP 65

  Fly    51 IYAFRGIRYAQSPVGQLRFANPVPETSWGDEVFNATSDSLVCPQ------PGV------------ 97
            :..|.|:.||..|:|..||..|....|| ..|.|||:....|||      |.:            
Human    66 VVQFLGVPYATPPLGARRFQPPEAPASW-PGVRNATTLPPACPQNLHGALPAIMLPVWFTDNLEA 129

  Fly    98 ----VSLMSEDCLKINVF--------TKSFED--------------KFPVMVYIHGGANVLGSGH 136
                |...|||||.:|::        ||..::              |.|||:::|||:.:.|:|:
Human   130 AATYVQNQSEDCLYLNLYVPTEDGPLTKKRDEATLNPPDTDIRDPGKKPVMLFLHGGSYMEGTGN 194

  Fly   137 -------SSYEAGPQYLLDQDVVFVAFNYRLGALGFLSTNSSETKGNFGFLDQVMALEWVRDHIS 194
                   ::|         .:|:....|||||.||||||.....|||:|.|||:.||.|:.::|:
Human   195 MFDGSVLAAY---------GNVIVATLNYRLGVLGFLSTGDQAAKGNYGLLDQIQALRWLSENIA 250

  Fly   195 HFGGDPELVTIIGISAGSMAVSLHLASPLSAGLFHRAILMSGSATNHFDID--NLFWTRKLAREL 257
            |||||||.:||.|..||:..|:|.:.|..|.|||.:||..||:|.:.:.::  .|.:||.||.::
Human   251 HFGGDPERITIFGSGAGASCVNLLILSHHSEGLFQKAIAQSGTAISSWSVNYQPLKYTRLLAAKV 315

  Fly   258 GCPMYDPTDVVECLRNETWTRIVEVCKAWETYQLVNMKWNYEIDGHFLHNHPTELIKEGNFNKVP 322
            ||...|..:.|||||.:....:|:.......|.:.   :...:||..:.:.|..|:::|.|....
Human   316 GCDREDSAEAVECLRRKPSRELVDQDVQPARYHIA---FGPVVDGDVVPDDPEILMQQGEFLNYD 377

  Fly   323 LLI-------------------SFTANEFDYNANVHLENQHLLHDFASNFVDYAPELFLYRHDAQ 368
            :||                   ..:|:.||:.              .|||||   .|:.|.....
Human   378 MLIGVNQGEGLKFVEDSAESEDGVSASAFDFT--------------VSNFVD---NLYGYPEGKD 425

  Fly   369 IGEKLKDFYLGDNTTEINSE-NIENFGQIFSD-AYIGHGVHRLVQLASHFTPVY-YTRMDYVGDQ 430
            :..:...|...|.....|.| ..:....:|:| .::...|......|.:.:||| ||...:    
Human   426 VLRETIKFMYTDWADRDNGEMRRKTLLALFTDHQWVAPAVATAKLHADYQSPVYFYTFYHH---- 486

  Fly   431 SLSAPLNGENKP--VGVGHADDLHYVLPGYWYG-PLMAAND--------SDVFMMERLTSWFTHF 484
                 ...|.:|  ....|.|:|.||     :| |::.|.|        :||.:...:.:::|:|
Human   487 -----CQAEGRPEWADAAHGDELPYV-----FGVPMVGATDLFPCNFSKNDVMLSAVVMTYWTNF 541

  Fly   485 AKTGTPLNSTD----------------IWPPCNSTVLKMLYNGVVTQVGSPGYSNRYAVWDKLFP 533
            ||||.|.....                :|...||...:.|:.|:..:|.....:|:.|.|.:|.|
Human   542 AKTGDPNQPVPQDTKFIHTKPNRFEEVVWSKFNSKEKQYLHIGLKPRVRDNYRANKVAFWLELVP 606

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3841NP_001188759.1 COesterase 27..528 CDD:278561 166/607 (27%)
Aes <116..>235 CDD:223730 54/139 (39%)
NLGN2NP_065846.1 COesterase 41..601 CDD:278561 166/604 (27%)
Aes <170..>268 CDD:223730 44/106 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 623..668
Required for interaction with LHFPL4. /evidence=ECO:0000250|UniProtKB:Q69ZK9 678..698
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 790..835
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142780
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.