DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3841 and si:dkey-193c22.1

DIOPT Version :9

Sequence 1:NP_001188759.1 Gene:CG3841 / 34278 FlyBaseID:FBgn0032131 Length:564 Species:Drosophila melanogaster
Sequence 2:NP_001093504.1 Gene:si:dkey-193c22.1 / 567837 ZFINID:ZDB-GENE-030131-7957 Length:370 Species:Danio rerio


Alignment Length:340 Identity:73/340 - (21%)
Similarity:111/340 - (32%) Gaps:124/340 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 SFEDKFPVMVYIHGGANVLGSGHSSYEAGPQYLLDQDVVFVAFNYRLGALGFLSTNSSETKGNFG 178
            |.|...||:|:::|||  .|||..|.     |.|    :.:.....|.|.......|...|||  
Zfish   113 SDESPVPVVVFVYGGA--WGSGDRSI-----YCL----LALQMAKELNASVICPDYSIYPKGN-- 164

  Fly   179 FLDQVM----ALEWVRDHISHFGGDPELVTIIGISAGS---MAVSLHLASPLSAGLFHRAILMSG 236
            .|:.|.    :|.|||.....|..|.:.:.:||.|||:   ...||.|||               
Zfish   165 VLNMVQDISDSLLWVRQKGHAFSLDQDNIILIGHSAGAHLCALTSLFLAS--------------- 214

  Fly   237 SATNHFDIDNLF-WTRKLARELGCPMYDPTDVVECLRNETWTRIVEVCKAWETYQLVNMKWNYEI 300
                  :::.|| .|.|           ..|:|..::.                 ::.:...|.|
Zfish   215 ------NVEELFIETNK-----------QKDLVTAIKG-----------------IIGLSGVYSI 245

  Fly   301 DGHFLHNHPTELIKEGNFNKVPLLISFTANEFDYNANVHLENQHLLHDFASNFVDYAPELFLYRH 365
            ..|:            |..||             .|..::...|...|...||..|:|...|   
Zfish   246 MDHY------------NHEKV-------------RAVEYVSTMHKAMDGVENFDYYSPTSLL--- 282

  Fly   366 DAQIGEKLKD----------FYLGDNTTEINSENIENFGQIFSDAYIGHGVHRLVQLASHFTPVY 420
                 :|:|:          .:.|.|...:..|:...|.::.:...|...:: |:...:|     
Zfish   283 -----KKMKEDQLKRVPPMALFHGTNDIIVPVESSVRFSELLTSLSIRMSLY-LIPKMNH----- 336

  Fly   421 YTRMDYVGDQSLSAP 435
               .|.|.|  |.||
Zfish   337 ---TDMVTD--LMAP 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3841NP_001188759.1 COesterase 27..528 CDD:278561 73/340 (21%)
Aes <116..>235 CDD:223730 37/125 (30%)
si:dkey-193c22.1NP_001093504.1 Aes 87..336 CDD:223730 66/318 (21%)
Abhydrolase 121..>210 CDD:304388 29/101 (29%)
Abhydrolase 167..336 CDD:304388 45/251 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1516
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.