DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mtpalpha and CDYL

DIOPT Version :9

Sequence 1:NP_609299.1 Gene:Mtpalpha / 34276 FlyBaseID:FBgn0028479 Length:783 Species:Drosophila melanogaster
Sequence 2:NP_001355054.1 Gene:CDYL / 9425 HGNCID:1811 Length:598 Species:Homo sapiens


Alignment Length:224 Identity:57/224 - (25%)
Similarity:95/224 - (42%) Gaps:22/224 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 NGVLVIKIDSPNAKVNSLGSEVSDEFERVIKDLETNPAVNS-AVLISGKPGCFVAGADIGMLEAC 121
            :|...|.:.:.:::.|||..||..|.:..   |.|..|.:| .||:|.....|..|.|.......
Human   350 DGFTHILLSTKSSENNSLNPEVMREVQSA---LSTAAADDSKLVLLSAVGSVFCCGLDFIYFIRR 411

  Fly   122 QTAE---EATLISHGAQVMFDRMERSKKPIVAAISGVCLGGGLELALACHYRIATKDSKTKLGLP 183
            .|.:   |:|.::...:...:...:.||||:.|::|..:|.|..:...|.  :...:.|.....|
Human   412 LTDDRKRESTKMAEAIRNFVNTFIQFKKPIIVAVNGPAIGLGASILPLCD--VVWANEKAWFQTP 474

  Fly   184 EVMLGLLPGGGGTVRLPKLTSVPTALDMELTGKQVRADRAKRLGIVDLLVDPLGPGLQPAEQNTI 248
            ....|..|.|..||..||:....:|.:|.|:|:::.|..|...|:|..:   ..||         
Human   475 YTTFGQSPDGCSTVMFPKIMGGASANEMLLSGRKLTAQEACGKGLVSQV---FWPG--------- 527

  Fly   249 EYLEKTAVQVANDLASGKLRVNREKSGLV 277
            .:.::..|:: .:|||....|..|...||
Human   528 TFTQEVMVRI-KELASCNPVVLEESKALV 555

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MtpalphaNP_609299.1 fa_ox_alpha_mit 38..775 CDD:131494 57/224 (25%)
crotonase-like 52..235 CDD:119339 47/180 (26%)
3HCDH_N 375..553 CDD:280833
3HCDH 556..651 CDD:279114
3HCDH 689..768 CDD:279114
CDYLNP_001355054.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..76
Interaction with EZH2. /evidence=ECO:0000269|PubMed:22009739 61..309
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 112..149
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 204..226
Acetyl-CoA-binding domain. /evidence=ECO:0000255 362..594 55/212 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.