DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mtpalpha and Echs1

DIOPT Version :9

Sequence 1:NP_609299.1 Gene:Mtpalpha / 34276 FlyBaseID:FBgn0028479 Length:783 Species:Drosophila melanogaster
Sequence 2:NP_444349.1 Gene:Echs1 / 93747 MGIID:2136460 Length:290 Species:Mus musculus


Alignment Length:241 Identity:73/241 - (30%)
Similarity:129/241 - (53%) Gaps:25/241 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 NGVLVIKIDSPNAKVNSLGSEVSDEFERVIKDLETNPAVNSAVLISGKPGCFVAGADIGMLE--A 120
            :.|.:|:::.|.| :|:|.:.:.:|..:.::..|.:||| .|::::|....|.|||||..::  .
Mouse    45 SSVGLIQLNRPKA-LNALCNGLIEELNQALETFEQDPAV-GAIVLTGGDKAFAAGADIKEMQNRT 107

  Fly   121 CQTAEEATLISHGAQVMFDRMERSKKPIVAAISGVCLGGGLELALACHYRIATKDSKTKLGLPEV 185
            .|....:..:||     :|.:.|.|||::||::|..||||.|||:.|.  |.....|.:.|.||:
Mouse   108 FQDCYSSKFLSH-----WDHITRVKKPVIAAVNGYALGGGCELAMMCD--IIYAGEKAQFGQPEI 165

  Fly   186 MLGLLPGGGGTVRLPKLTSVPTALDMELTGKQVRADRAKRLGIVDLLVDPLGPGLQPAEQNTIEY 250
            :||.:||.|||.||.:......|::|.|||.::.|..||:.|:|..:.             .:|.
Mouse   166 LLGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIF-------------PVEK 217

  Fly   251 LEKTAVQVANDLAS-GKLRVNREKSGLVSKIQSFVMDTDFVKNKIF 295
            |.:.|:|.|..:|| .|:.|...|..:.:..:..:.:.:.::.::|
Mouse   218 LVEEAIQCAEKIASNSKIVVAMAKESVNAAFEMTLTEGNKLEKRLF 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MtpalphaNP_609299.1 fa_ox_alpha_mit 38..775 CDD:131494 73/241 (30%)
crotonase-like 52..235 CDD:119339 62/178 (35%)
3HCDH_N 375..553 CDD:280833
3HCDH 556..651 CDD:279114
3HCDH 689..768 CDD:279114
Echs1NP_444349.1 crotonase-like 32..288 CDD:304874 73/241 (30%)
PRK05617 36..288 CDD:235533 73/241 (30%)
Substrate binding. /evidence=ECO:0000250 98..101 2/2 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.