DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mtpalpha and ECI1

DIOPT Version :9

Sequence 1:NP_609299.1 Gene:Mtpalpha / 34276 FlyBaseID:FBgn0028479 Length:783 Species:Drosophila melanogaster
Sequence 2:NP_013386.1 Gene:ECI1 / 850990 SGDID:S000004274 Length:280 Species:Saccharomyces cerevisiae


Alignment Length:184 Identity:39/184 - (21%)
Similarity:74/184 - (40%) Gaps:15/184 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 NKHLHTKVVNGVLVIKIDSPNAKVNSLGSEVSDEFERVIKDLETNPAVNSAVL-ISGKPGCFVAG 112
            |:.:..::.....:|.:.:|: .:|:|..|.......:::..:.|..|...:: .||:  .|.:|
Yeast     8 NEKISYRIEGPFFIIHLMNPD-NLNALEGEDYIYLGELLELADRNRDVYFTIIQSSGR--FFSSG 69

  Fly   113 ADIGMLEACQ-------TAEEATLISHGAQ---VMFDRMERSKKPIVAAISGVCLGGGLELALAC 167
            ||...:...|       .:|.:..:|:...   .:.|...:..|.::..::|..:|....|...|
Yeast    70 ADFKGIAKAQGDDTNKYPSETSKWVSNFVARNVYVTDAFIKHSKVLICCLNGPAIGLSAALVALC 134

  Fly   168 HYRIATKDSKTKLGLPEVMLGLLPGGGGTVRLPKLTSVPTALDMELTGKQVRAD 221
            ....:..| |..|..|...|||:..||.||.||......|..:..:..|..:.|
Yeast   135 DIVYSIND-KVYLLYPFANLGLITEGGTTVSLPLKFGTNTTYECLMFNKPFKYD 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MtpalphaNP_609299.1 fa_ox_alpha_mit 38..775 CDD:131494 39/184 (21%)
crotonase-like 52..235 CDD:119339 38/181 (21%)
3HCDH_N 375..553 CDD:280833
3HCDH 556..651 CDD:279114
3HCDH 689..768 CDD:279114
ECI1NP_013386.1 CaiD 6..243 CDD:223955 39/184 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.