DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mtpalpha and echdc1

DIOPT Version :9

Sequence 1:NP_609299.1 Gene:Mtpalpha / 34276 FlyBaseID:FBgn0028479 Length:783 Species:Drosophila melanogaster
Sequence 2:NP_001315065.1 Gene:echdc1 / 553585 ZFINID:ZDB-GENE-050522-370 Length:302 Species:Danio rerio


Alignment Length:350 Identity:82/350 - (23%)
Similarity:138/350 - (39%) Gaps:74/350 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SAVGQISRQQLLQNKCTRALPISAQLLQRRRLMSTNPAPVANKHLHTKVVNGVLVIKIDSPNAKV 72
            |||.:|.:|       .||....:.:..|.:|::   .|..:..|.....:|:.|:.:.:| |::
Zfish    17 SAVRKILQQ-------NRAFCSGSSVGIREKLLA---FPGGSVELQKLQESGIAVLTVSNP-ARM 70

  Fly    73 NSLGSEVSDEFERVIKDLE--TNPAVNSAVLISGKPGCFVAGADIGMLEACQTAEEATLISHGAQ 135
            |:....:..|.|:.:.:||  |.   ..||::.|..|.|.:|:|:..:.|.....:...:....|
Zfish    71 NAFSGCMMLELEQRVNELEIWTE---GKAVIVQGAAGNFCSGSDLNAVRAIANPHDGMKMCEFMQ 132

  Fly   136 VMFDRMERSKKPIVAAISGVCLGGGLELALACHYRIATKDSKTKLGLPEVMLGLLPGGGGTVRLP 200
            ....|:.|.....||.:.|..||||.||..||.:|:.|.|:  .:......:||:||.||..||.
Zfish   133 NTLARLLRLPLISVALVEGRALGGGAELTTACDFRLMTSDA--VIQFVHKHMGLVPGWGGAARLV 195

  Fly   201 KLTSVPTALDMELTGKQVRADRAKRLGIVDLLVDPLGPGLQPAEQNTIEYLEKTAVQVANDLASG 265
            .:.....||.:....::|..|..|::|:||                  |.|:.::       ..|
Zfish   196 GIIGSRNALKLLSGARKVDPDYGKQMGLVD------------------EVLQCSS-------GEG 235

  Fly   266 KLRVNREKSGLVSKIQSFVMDTDFVKNKIFDTARKQVLKASNGLYPAPL--KILDVIRAGVDKGT 328
            |...:.|.           ....|:|.                  |||:  .|..|:.:|.:...
Zfish   236 KALAHAEH-----------WIAPFIKG------------------PAPVIQAIKKVVVSGRELSL 271

  Fly   329 DAGYEAERKGFGELSATPESKGLIA 353
            |...:.||..||.:...|.:...:|
Zfish   272 DEALKCERSVFGTVWGGPANLEALA 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MtpalphaNP_609299.1 fa_ox_alpha_mit 38..775 CDD:131494 73/319 (23%)
crotonase-like 52..235 CDD:119339 52/184 (28%)
3HCDH_N 375..553 CDD:280833
3HCDH 556..651 CDD:279114
3HCDH 689..768 CDD:279114
echdc1NP_001315065.1 crotonase-like 55..244 CDD:119339 56/230 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.