DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mtpalpha and AUH

DIOPT Version :9

Sequence 1:NP_609299.1 Gene:Mtpalpha / 34276 FlyBaseID:FBgn0028479 Length:783 Species:Drosophila melanogaster
Sequence 2:XP_005252123.1 Gene:AUH / 549 HGNCID:890 Length:349 Species:Homo sapiens


Alignment Length:244 Identity:71/244 - (29%)
Similarity:118/244 - (48%) Gaps:27/244 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 VLVIKIDSPNAKVNSLGSEVSDEFERVIKDLETNPAVNSAVLISGKPGCFVAGADIGMLEACQTA 124
            ::|:.|:....| |||...:.....:.:..|:::..|.:.::.|..||.|.||||:.......::
Human    99 IVVLGINRAYGK-NSLSKNLIKMLSKAVDALKSDKKVRTIIIRSEVPGIFCAGADLKERAKMSSS 162

  Fly   125 EEATLISHGAQVMFDRMERSKKPIVAAISGVCLGGGLELALACHYRIATKDSKTKLGLPEVMLGL 189
            |....:|....|:.| :.....|.:|||.|:.|||||||||||..|:|.  |..|:||.|..|.:
Human   163 EVGPFVSKIRAVIND-IANLPVPTIAAIDGLALGGGLELALACDIRVAA--SSAKMGLVETKLAI 224

  Fly   190 LPGGGGTVRLPKLTSVPTALDMELTGKQVRADRAKRLGIVDLLVDPLGPG---LQPAEQNTIEYL 251
            :||||||.|||:...:..|.::..:.:.:....||.:|::..:::....|   .:.|.....|:|
Human   225 IPGGGGTQRLPRAIGMSLAKELIFSARVLDGKEAKAVGLISHVLEQNQEGDAAYRKALDLAREFL 289

  Fly   252 EK--TAVQVANDLASGKLRVNREKSGLVSKIQSFVMDTDFVKNKIFDTA 298
            .:  .|::||      ||.:|:.            |:.|.|.....:.|
Human   290 PQGPVAMRVA------KLAINQG------------MEVDLVTGLAIEEA 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MtpalphaNP_609299.1 fa_ox_alpha_mit 38..775 CDD:131494 71/244 (29%)
crotonase-like 52..235 CDD:119339 57/174 (33%)
3HCDH_N 375..553 CDD:280833
3HCDH 556..651 CDD:279114
3HCDH 689..768 CDD:279114
AUHXP_005252123.1 crotonase-like 99..349 CDD:304874 71/244 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.