DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mtpalpha and Echdc1

DIOPT Version :9

Sequence 1:NP_609299.1 Gene:Mtpalpha / 34276 FlyBaseID:FBgn0028479 Length:783 Species:Drosophila melanogaster
Sequence 2:XP_006512860.1 Gene:Echdc1 / 52665 MGIID:1277169 Length:374 Species:Mus musculus


Alignment Length:306 Identity:83/306 - (27%)
Similarity:137/306 - (44%) Gaps:58/306 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LSAVGQISRQQLLQ----NKCTRALPISAQLLQRRRLMSTNPAPVANKH-LHTKVV--------- 57
            :|..|..|:.|.|:    .||.    :::.|..|.:|:.|..:.....| .|.:.|         
Mouse    59 VSGHGSASQSQGLRAGEMAKCL----LTSSLSVRTKLLQTGVSLYNTSHGFHEEEVKKILEQFPG 119

  Fly    58 ---------NGVLVIKIDSPNAKVNSL-GSEVSDEFERVIKDLETNPAVNSAVLISGKPGCFVAG 112
                     ||:.::.:::|| |:|:. |..:....|||| :|| |......::|.|....|.:|
Mouse   120 GSIDLLKKQNGIGILTLNNPN-KMNAFSGVMMLQLLERVI-ELE-NWTEGKGLIIHGAKNTFCSG 181

  Fly   113 ADIGMLEACQTAEEATLISHGAQVMFDRMERSKKPIVAAISGVCLGGGLELALACHYRIATKDSK 177
            :|:..::|..|.|....:|...|....|..|.....||.:.|..:|||.||..||.:|:.|::|.
Mouse   182 SDLNAVKALSTPESGVALSMFMQNTLTRFMRLPLISVALVQGWAMGGGAELTTACDFRLMTEESV 246

  Fly   178 TKLGLPEVMLGLLPGGGGTVRLPKLTSVPTALDMELTGK-QVRADRAKRLGIVDLLVDPLGPGLQ 241
            .:....|  :|::|..|||.||.::.....||.: |:|. ::.:..|..:|:.|.:       ||
Mouse   247 IRFVHKE--MGIVPSWGGTSRLVEIIGSRQALKV-LSGTLKLDSKEALNIGLTDEV-------LQ 301

  Fly   242 PAEQNTI-----EYLEKTAVQVANDLASGKLRVNREKSGLVSKIQS 282
            |:::.|.     |:|||        ..||..:|.|   ||...:.|
Mouse   302 PSDETTALEQAQEWLEK--------FVSGPPQVIR---GLKKSVCS 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MtpalphaNP_609299.1 fa_ox_alpha_mit 38..775 CDD:131494 74/271 (27%)
crotonase-like 52..235 CDD:119339 56/202 (28%)
3HCDH_N 375..553 CDD:280833
3HCDH 556..651 CDD:279114
3HCDH 689..768 CDD:279114
Echdc1XP_006512860.1 crotonase-like 124..318 CDD:119339 60/206 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.