DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mtpalpha and zgc:101569

DIOPT Version :9

Sequence 1:NP_609299.1 Gene:Mtpalpha / 34276 FlyBaseID:FBgn0028479 Length:783 Species:Drosophila melanogaster
Sequence 2:NP_001005995.2 Gene:zgc:101569 / 449822 ZFINID:ZDB-GENE-041010-72 Length:309 Species:Danio rerio


Alignment Length:307 Identity:85/307 - (27%)
Similarity:137/307 - (44%) Gaps:56/307 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 QRRRLMSTNPAPVANKHLHTKVVNGVLVIKIDSPNAKVNSLGSEVSDEFERVIKDLETNPAVNSA 99
            :|:...|.:..||.::..     ..|::|.|:.|.|: |::..|.:......:...:.:.::|..
Zfish    37 ERKTTSSGSNGPVVSERR-----GAVMLIGINRPEAR-NAVNRETAQRLTEELSAFDQDDSLNVT 95

  Fly   100 VLISGKPGCFVAGADIGML-EACQTAEEATLISHGAQVMFDRMERSKKPIVAAISGVCLGGGLEL 163
            ||. |..|.|.||.|:..| ....:.|....:|.|...|.....|..||::||:||..:.|||||
Zfish    96 VLY-GVGGNFCAGFDLKELAHGSDSLELEQDVSSGPGPMGPSRMRLSKPLIAAVSGYAVAGGLEL 159

  Fly   164 ALACHYRIATKDS-----KTKLGLPEVMLGLLPGGGGTVRLPKLTSVPTALDMELTGKQVRADRA 223
            ||....|:|.:.|     ..:.|:|.:       .|||||||:|..:..|||:.|||:.|:|..|
Zfish   160 ALLADMRVAEESSIMGVFCRRFGVPLI-------DGGTVRLPQLIGLSRALDLILTGRPVKAHEA 217

  Fly   224 KRLGIVDLLVDPLGPGLQPAEQNTIEYLEKTAV--QVANDLASGKLRVNREKSGLVSKIQSFVMD 286
            ...|:.:.:| |.|..||.|    :|..|:.:.  |:.       ||.:|.     |...:....
Zfish   218 LAFGLANRVV-PDGQALQEA----LELAEQVSAFPQLC-------LRADRN-----SAYHALFDS 265

  Fly   287 TDFVKNKIFDTARKQVLKASNGLYPAPLKILDVI------RAGVDKG 327
            |.|.:...::|        .||:   |:.|.:.:      .:||.:|
Zfish   266 TSFNQAMQYET--------DNGI---PVVIAEAVAGAAKFSSGVGRG 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MtpalphaNP_609299.1 fa_ox_alpha_mit 38..775 CDD:131494 84/304 (28%)
crotonase-like 52..235 CDD:119339 59/188 (31%)
3HCDH_N 375..553 CDD:280833
3HCDH 556..651 CDD:279114
3HCDH 689..768 CDD:279114
zgc:101569NP_001005995.2 PRK08259 46..304 CDD:236205 83/298 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.