DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mtpalpha and CG5611

DIOPT Version :9

Sequence 1:NP_609299.1 Gene:Mtpalpha / 34276 FlyBaseID:FBgn0028479 Length:783 Species:Drosophila melanogaster
Sequence 2:NP_001263016.2 Gene:CG5611 / 43318 FlyBaseID:FBgn0039531 Length:326 Species:Drosophila melanogaster


Alignment Length:331 Identity:87/331 - (26%)
Similarity:134/331 - (40%) Gaps:66/331 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TRFLSAVGQISRQQLLQNKCTRALPISAQLLQRRRLMSTNPAP----VANKHLHTKVVNGVLVIK 64
            :||:..:.|.:.|  ..:.|.|   ||...::.....|...||    :..|..|      :.:|.
  Fly     2 SRFVYKLLQSANQ--TSSGCRR---ISLATVRNAESESQEGAPARTVLVEKDSH------ITLIG 55

  Fly    65 IDSPNAKVNSLGSEVSDEFERVIKDLETNPAVNSAVLISGKPGCFVAGADIGMLEA-CQTAEEAT 128
            ::....: ||:.:..:::....|...|.:......||. |..|.|.||.|:..||| .|......
  Fly    56 LNREQQR-NSIDANTAEQLTEAISQFEADDTSPVGVLY-GIGGSFCAGYDLEELEAEAQRGSLNF 118

  Fly   129 LISHGAQVMFDRMERSKKPIVAAISGVCLGGGLELALACHYRIATKDSKTKLGLPEVMLGLLPGG 193
            |:.|...|...| ...:||:|..|||.|:.|||||||.|..|:  .:....||.....||:....
  Fly   119 LLRHEGSVGPTR-RHLRKPLVCGISGFCVAGGLELALMCDLRV--MEDTAVLGFFNRRLGVPLSD 180

  Fly   194 GGTVRLPKLTSVPTALDMELTGKQVRADRAKRLGIVDLLV---DPLG------------------ 237
            ||||||........||::..||:::.:..|:|:|:|:.:|   ..||                  
  Fly   181 GGTVRLAAAVGYSNALEIIATGRRIYSGEARRIGLVNRVVATGTALGQAVNLAFSIAKFPMASLM 245

  Fly   238 ---------------PGLQPAEQNTIEYLEKTAVQVANDLASGKLRVNREKSGLVSKIQSFVMDT 287
                           ||...|..|  |.:..|: .:..|:..|   |.|.|:   |:|:....|:
  Fly   246 HDRNAVLENANAYNKPGFHVASYN--EIMNVTS-DMITDMQEG---VKRFKN---SEIKGPKTDS 301

  Fly   288 DFVKNK 293
            ..:|.|
  Fly   302 WSIKEK 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MtpalphaNP_609299.1 fa_ox_alpha_mit 38..775 CDD:131494 79/297 (27%)
crotonase-like 52..235 CDD:119339 57/186 (31%)
3HCDH_N 375..553 CDD:280833
3HCDH 556..651 CDD:279114
3HCDH 689..768 CDD:279114
CG5611NP_001263016.2 crotonase-like 39..256 CDD:304874 61/227 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.