DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mtpalpha and CG5044

DIOPT Version :9

Sequence 1:NP_609299.1 Gene:Mtpalpha / 34276 FlyBaseID:FBgn0028479 Length:783 Species:Drosophila melanogaster
Sequence 2:NP_732020.2 Gene:CG5044 / 41869 FlyBaseID:FBgn0038326 Length:386 Species:Drosophila melanogaster


Alignment Length:198 Identity:57/198 - (28%)
Similarity:93/198 - (46%) Gaps:34/198 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 LMSTNPAPVA-------NKHLHTKVVNGVLVIKIDSPNAKVNSLGSEVSDEFERVIKDLETNPAV 96
            :..|.|..:|       :..|.|:..|..::| ::.|.| :|::..|:   ..::.|.|:.....
  Fly    28 ISQTKPTTMALSVRQSSSSVLATESSNKGMII-LNRPKA-LNAINLEM---VRKIYKHLKKCEKS 87

  Fly    97 NSAVLISGK-PGCFVAGADI-GMLEACQTAEEATLISHGAQVMFDRMERS--------KKPIVAA 151
            .|.|:|.|. ...|.||.|: .::||..|.|..:         |.|.|.|        |.|.:|.
  Fly    88 KSLVIIKGTGDKAFCAGGDVRALVEAGPTDESKS---------FFREEYSTNALIGNYKIPYIAI 143

  Fly   152 ISGVCLGGGLELALACHYRIATKDSKTKLGLPEVMLGLLPGGGGTVRLPKLTSVPTALDMELTGK 216
            |.|:.:|||:.|::...||:|:  .:|...:||..:||.|..||:..||:|.. ...|.:.|||.
  Fly   144 IDGITMGGGVGLSVHGKYRVAS--DRTLFAMPETAIGLFPDVGGSYFLPRLQG-KLGLYLGLTGY 205

  Fly   217 QVR 219
            ::|
  Fly   206 RLR 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MtpalphaNP_609299.1 fa_ox_alpha_mit 38..775 CDD:131494 57/198 (29%)
crotonase-like 52..235 CDD:119339 54/178 (30%)
3HCDH_N 375..553 CDD:280833
3HCDH 556..651 CDD:279114
3HCDH 689..768 CDD:279114
CG5044NP_732020.2 PRK05617 44..376 CDD:235533 54/182 (30%)
ECH_2 56..374 CDD:292731 51/170 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.