DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mtpalpha and Had2

DIOPT Version :9

Sequence 1:NP_609299.1 Gene:Mtpalpha / 34276 FlyBaseID:FBgn0028479 Length:783 Species:Drosophila melanogaster
Sequence 2:NP_610974.1 Gene:Had2 / 36624 FlyBaseID:FBgn0033949 Length:315 Species:Drosophila melanogaster


Alignment Length:269 Identity:64/269 - (23%)
Similarity:121/269 - (44%) Gaps:31/269 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   376 VGVLGAGLMGAGIVQVSVDKGYQVVMKDATEAGLARGIGQVQKGL----ETAVKRKRISALERDQ 436
            :|::|:||:|.....:....||:|.:.|..|:.||..:.::.|.|    |.:..|..|.|.|:  
  Fly     6 IGIVGSGLIGRAWAMLFAAAGYRVQLYDILESQLATALQELDKDLHRLEEQSALRGNIRASEQ-- 68

  Fly   437 TLASLRPTLDYSDF-KNADIIIEAVFEDIKVKHRVIKELEAVVPEHCVIATNTSAIPITKIAAGS 500
             .|.:..|....:. :.|..|.|.|.|.:.:|..:..:|:.::.|..|:|::||....:..:.|.
  Fly    69 -FALIGVTTRLEELTREAVHIQECVPEVLHLKKSLYSQLDELLEEQTVVASSTSTFMPSLYSEGL 132

  Fly   501 SRPEKVVGMHYFSPVDKMQLLEIITHPGTSKDTIAQAVAVGLKQGKVVITV-GDGPGFYTTRILS 564
            .:.::::..|..:|...:.|:||:..|.||...:.:...:.|..|:..:|: .:..||.|.||..
  Fly   133 QKRQQMLVAHPLNPPYFIPLVEIVPAPWTSPSAVERTRDLMLSLGQRPVTLKREIQGFATNRIQY 197

  Fly   565 TMLSEAIRLLQEGV-DPKDLDQY----------------TKKFGFPVGAATLADEVGIDVGSHIA 612
            .:|:|..||:..|: ...|:|:.                |.....|.|.|......|.::.:   
  Fly   198 AILNEVWRLVGSGILSVADVDRVLSQGLGLRYALLGSLETAHLNAPGGVADYFQRFGGEISA--- 259

  Fly   613 VDLAKAFGE 621
              ::..:||
  Fly   260 --VSATYGE 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MtpalphaNP_609299.1 fa_ox_alpha_mit 38..775 CDD:131494 64/269 (24%)
crotonase-like 52..235 CDD:119339
3HCDH_N 375..553 CDD:280833 45/182 (25%)
3HCDH 556..651 CDD:279114 19/83 (23%)
3HCDH 689..768 CDD:279114
Had2NP_610974.1 PRK06129 5..312 CDD:235706 64/269 (24%)
3HCDH_N 5..184 CDD:280833 45/180 (25%)
3HCDH 189..>256 CDD:279114 17/66 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454581
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.