DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mtpalpha and CG8778

DIOPT Version :9

Sequence 1:NP_609299.1 Gene:Mtpalpha / 34276 FlyBaseID:FBgn0028479 Length:783 Species:Drosophila melanogaster
Sequence 2:NP_610805.1 Gene:CG8778 / 36392 FlyBaseID:FBgn0033761 Length:299 Species:Drosophila melanogaster


Alignment Length:361 Identity:99/361 - (27%)
Similarity:150/361 - (41%) Gaps:95/361 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 AQLLQRRRLMSTNPAPVANKHLHTKVV--------NGVLVIKIDSPNAKVNSLGSEVSDEFERVI 87
            |:.|.|..:.|.|.|..|.....|:|:        .|:.||.::.|.|| ||....:.:.|..|:
  Fly    12 ARQLARPLVASRNLASAAPYGDGTEVLVERLDGARQGISVIGLNRPAAK-NSFSRGMVETFNDVL 75

  Fly    88 KDLETNPAVNSAVLISGKPGCFVAGADI----GMLEACQTAEEATLISHGAQVMFDRMERSKKPI 148
            :|::.:......||.|..||.|.||||:    ||     |.||||......:.:...:|:...|:
  Fly    76 EDIKKDNGSRVVVLRSLSPGIFCAGADLKERKGM-----TPEEATEFVKELRGLLIAIEQLPMPV 135

  Fly   149 VAAISGVCLGGGLELALACHYRIATKDSKTKLGLPEVMLGLLPGGGGTVRLPKLTSVPTALDMEL 213
            :||:.|..||||||:||||..|.|..|  ||:||.|..|.::||.|||.|||::.|...|.::..
  Fly   136 IAAVDGAALGGGLEMALACDIRTAASD--TKMGLVETRLAIIPGAGGTQRLPRILSPALAKELIF 198

  Fly   214 TGKQVRADRAKRLGIVDLLVDPLGPGLQPAEQNTIEYLEKTAVQVANDLASGKLRVNREKSGLVS 278
            |.:......||.||:|:.:|.                                            
  Fly   199 TARVFNGAEAKDLGLVNHVVK-------------------------------------------- 219

  Fly   279 KIQSFVMDTDFVKNKIFDTARKQVLKASNGLYP-APLKILDVIRAGVDKGTD----AGYEAERKG 338
                        :|:..|.|.:|.||.:..:.| .|:.: .:.:..:|||..    .||..|...
  Fly   220 ------------QNETQDAAYQQALKLAEEILPNGPVGV-RMAKLAIDKGMQVDLATGYSIEEIC 271

  Fly   339 FGELSATPES-KGLIALFRGQTECKKNRFGKPERPV 373
            :.::..|.:. :||.|            |.:..:||
  Fly   272 YSQVIPTKDRLEGLAA------------FAEKRKPV 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MtpalphaNP_609299.1 fa_ox_alpha_mit 38..775 CDD:131494 96/354 (27%)
crotonase-like 52..235 CDD:119339 71/194 (37%)
3HCDH_N 375..553 CDD:280833
3HCDH 556..651 CDD:279114
3HCDH 689..768 CDD:279114
CG8778NP_610805.1 crotonase-like 48..299 CDD:304874 90/325 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.