DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mtpalpha and Echdc1

DIOPT Version :9

Sequence 1:NP_609299.1 Gene:Mtpalpha / 34276 FlyBaseID:FBgn0028479 Length:783 Species:Drosophila melanogaster
Sequence 2:NP_001007735.1 Gene:Echdc1 / 361465 RGDID:1359654 Length:299 Species:Rattus norvegicus


Alignment Length:234 Identity:67/234 - (28%)
Similarity:114/234 - (48%) Gaps:29/234 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 KVVNGVLVIKIDSPNAKVNSL-GSEVSDEFERVIKDLETNPAVNSAVLISGKPGCFVAGADIGML 118
            |..||:.::.:::.| |:|:. |:.:....|||| :|| |......:::.|....|.:|:|:..:
  Rat    51 KKQNGIGILTLNNSN-KMNAFSGAMMLQLLERVI-ELE-NWTEGKGLIVHGAKNTFCSGSDLNAV 112

  Fly   119 EACQTAEEATLISHGAQVMFDRMERSKKPIVAAISGVCLGGGLELALACHYRIATKDSKTKLGLP 183
            :|..|.|....:|...|....|..|.....||.:.|..:|||.||..||.:|:.|::|..:....
  Rat   113 KALSTPENGVALSMFMQNTLTRFMRLPLISVALVQGWAMGGGAELTTACDFRLMTEESVIRFVHK 177

  Fly   184 EVMLGLLPGGGGTVRLPKLTSVPTALDMELTGK-QVRADRAKRLGIVDLLVDPLGPGLQPAEQNT 247
            |  :|::|..||..||.::.....||.: |:|. ::.:..|.|:|:.|.:       |||::   
  Rat   178 E--MGIVPSWGGASRLVEIIGSRQALKV-LSGTFKLDSKEALRIGLADEV-------LQPSD--- 229

  Fly   248 IEYLEKTAVQVAND----LASGKLRVNREKSGLVSKIQS 282
                |.||::.|.:    ..||..:|.|   ||...:.|
  Rat   230 ----EATALEQAQEWLEQFVSGPAQVIR---GLKKSVCS 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MtpalphaNP_609299.1 fa_ox_alpha_mit 38..775 CDD:131494 67/234 (29%)
crotonase-like 52..235 CDD:119339 53/181 (29%)
3HCDH_N 375..553 CDD:280833
3HCDH 556..651 CDD:279114
3HCDH 689..768 CDD:279114
Echdc1NP_001007735.1 crotonase-like 52..243 CDD:119339 59/210 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.