DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mtpalpha and CG4594

DIOPT Version :9

Sequence 1:NP_609299.1 Gene:Mtpalpha / 34276 FlyBaseID:FBgn0028479 Length:783 Species:Drosophila melanogaster
Sequence 2:NP_001260305.1 Gene:CG4594 / 34316 FlyBaseID:FBgn0032161 Length:280 Species:Drosophila melanogaster


Alignment Length:294 Identity:76/294 - (25%)
Similarity:117/294 - (39%) Gaps:69/294 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 RLMSTNPAPVANKHLHTKVVN---GVLVIKIDSPNAKVNSLGSEVSDEFERVIKDLETNPAVNSA 99
            |||||     |.| |.|..:|   |:..:.::.|  .|||...::..:.:..|.::|.|.: ...
  Fly    17 RLMST-----ATK-LTTVEINDKTGIATLTMNRP--PVNSQNVQLLLDLQTSISEIENNKS-RGL 72

  Fly   100 VLISGKPGCFVAGADIGMLEACQT-AEEATLISHGAQVMFDRMERSKKPIVAAISGVCLGGGLEL 163
            :|.|.....|.||.||  .|...| .|....:....|.::..:..:..|..|||:|....||..|
  Fly    73 ILTSASSNVFSAGLDI--FEMYNTDVERLRTVWTELQNVWIALYGTTLPTAAAINGHAPAGGCLL 135

  Fly   164 ALACHYRIATKDSKTKLGLPEVMLGL-----LPGGGGTVRLPKLTSVPTALDMELT-GKQVRADR 222
            |.||.||:...:  ..:||.|..||:     |..|..:: |||..:     :..|| |:......
  Fly   136 ATACEYRVMRPN--FLIGLNEAQLGIIAPKWLMSGFASI-LPKRVA-----ERALTQGRMFTTQE 192

  Fly   223 AKRLGIVDLLVDPLGPGLQPAEQNTIEYLEKTAVQV-----ANDLASGKLRVN------------ 270
            |..:|::|.:.           .:..|.|||.|..:     .|.||.|..::.            
  Fly   193 AFEVGLIDEIA-----------SSKEEALEKCAAFIGTFAKVNPLARGLTKLQFRGDNIKEFEMI 246

  Fly   271 REK----------SGLVSKIQSFVMDTDFVKNKI 294
            |||          |..|.|:....::.  :|||:
  Fly   247 REKDIADFVALASSPGVQKVMGAYLEN--LKNKV 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MtpalphaNP_609299.1 fa_ox_alpha_mit 38..775 CDD:131494 76/294 (26%)
crotonase-like 52..235 CDD:119339 51/192 (27%)
3HCDH_N 375..553 CDD:280833
3HCDH 556..651 CDD:279114
3HCDH 689..768 CDD:279114
CG4594NP_001260305.1 crotonase-like 35..275 CDD:304874 63/265 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.