DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mtpalpha and echdc2

DIOPT Version :9

Sequence 1:NP_609299.1 Gene:Mtpalpha / 34276 FlyBaseID:FBgn0028479 Length:783 Species:Drosophila melanogaster
Sequence 2:NP_997953.1 Gene:echdc2 / 338247 ZFINID:ZDB-GENE-030219-147 Length:301 Species:Danio rerio


Alignment Length:215 Identity:71/215 - (33%)
Similarity:108/215 - (50%) Gaps:7/215 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 NGVLVIKIDSPNAKVNSLGSEVSDEFERVIKDLETNPAVNSAVLISGKPGCFVAGADIGMLEACQ 122
            ||::.:.:....|: ||||.....:...::..|:.:.||...|..|..||.|.||||  :.|..|
Zfish    49 NGIVEVLMCRERAR-NSLGHVFVGQMRDLVSSLQHDSAVRVLVFRSLIPGVFCAGAD--LKERAQ 110

  Fly   123 TAE-EATLISHGAQVMFDRMERSKKPIVAAISGVCLGGGLELALACHYRIATKDSKTKLGLPEVM 186
            .:. ||.|..||.:.:.:.:.....|.:||:.|..|||||||||||..|.|...:  ::||.|..
Zfish   111 MSNAEAELFVHGLRSLMNDIAALPMPTIAAVDGFALGGGLELALACDLRTAAHCA--QMGLIETT 173

  Fly   187 LGLLPGGGGTVRLPKLTSVPTALDMELTGKQVRADRAKRLGIVDLLVDPLGPGLQPAEQNTIEYL 251
            .|||||.||:.|||:......|.::..||::|..::|..||:|:..| |.......|.:..:...
Zfish   174 RGLLPGAGGSQRLPRTVGFAVAKELIFTGRRVGGEQAVNLGLVNRSV-PQNQTGDAAHREALSLA 237

  Fly   252 EKTAVQVANDLASGKLRVNR 271
            .:...|....:...|:.:||
Zfish   238 REILPQAPIAVRMAKVAMNR 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MtpalphaNP_609299.1 fa_ox_alpha_mit 38..775 CDD:131494 71/215 (33%)
crotonase-like 52..235 CDD:119339 65/177 (37%)
3HCDH_N 375..553 CDD:280833
3HCDH 556..651 CDD:279114
3HCDH 689..768 CDD:279114
echdc2NP_997953.1 crotonase-like 47..301 CDD:304874 71/215 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.