DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mtpalpha and Hibch

DIOPT Version :9

Sequence 1:NP_609299.1 Gene:Mtpalpha / 34276 FlyBaseID:FBgn0028479 Length:783 Species:Drosophila melanogaster
Sequence 2:XP_006244957.1 Gene:Hibch / 301384 RGDID:1308392 Length:385 Species:Rattus norvegicus


Alignment Length:308 Identity:83/308 - (26%)
Similarity:137/308 - (44%) Gaps:40/308 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 RLMSTNPAPVANKHL----HTKVVNGVL-------VIKIDSPNAKVNSLGSEVSDEFERVIKDLE 91
            |..|...|.|..:||    ||:....:|       ||.::.|.. :|:|...:..:....:|..|
  Rat    12 RFSSIRRASVILQHLRMSKHTETAEVLLERRGCAGVITLNRPKL-LNALSLNMIRQIYPQLKKWE 75

  Fly    92 TNPAVNSAVLISGKPG-CFVAGADIGMLEACQTAEEATL---ISHGAQVMFDRMERSKKPIVAAI 152
            .:|. ...::|.|..| .|.||.||..|...:.|.: ||   :.....::.:.:...:||.||.|
  Rat    76 RDPD-TFLIIIKGAGGKAFCAGGDIKALSEAKKAGQ-TLSQDLFREEYILNNAIASCQKPYVALI 138

  Fly   153 SGVCLGGGLELALACHYRIATKDSKTKLGLPEVMLGLLPGGGGTVRLPKLTSVPTALDMELTGKQ 217
            .|:.:|||:.|::...:|:||:  ::...:||..:||.|..||...||:|.. .....:.|||.:
  Rat   139 DGITMGGGVGLSVHGQFRVATE--RSLFAMPETGIGLFPDVGGGYFLPRLQG-KLGYFLALTGFR 200

  Fly   218 VRADRAKRLGIVDLLVDPLGPGLQPAEQNTIEYLEKTAVQVANDLAS--GKLRVNREKSGL---- 276
            ::.....|.||....||  ...|...|:..:.....:|..||..|.|  .|.::.::||.:    
  Rat   201 LKGRDVHRAGIATHFVD--SEKLHVLEEELLALKSPSAEDVAGVLESYHAKSKMGQDKSIIFEEH 263

  Fly   277 VSKIQS-FVMDTDFVKNKIFDTARK-------QVLKASNGLYPAPLKI 316
            :.||.| |..:|   ..:|.:..|:       :.:|..|.:.|..|||
  Rat   264 MDKINSCFSANT---VEQILENLRQDGSPFAMEQIKVINKMSPTSLKI 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MtpalphaNP_609299.1 fa_ox_alpha_mit 38..775 CDD:131494 83/308 (27%)
crotonase-like 52..235 CDD:119339 54/197 (27%)
3HCDH_N 375..553 CDD:280833
3HCDH 556..651 CDD:279114
3HCDH 689..768 CDD:279114
HibchXP_006244957.1 PRK05617 33..377 CDD:235533 75/287 (26%)
ECH_2 46..374 CDD:292731 74/274 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.