DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mtpalpha and Cdyl2

DIOPT Version :9

Sequence 1:NP_609299.1 Gene:Mtpalpha / 34276 FlyBaseID:FBgn0028479 Length:783 Species:Drosophila melanogaster
Sequence 2:XP_017456726.1 Gene:Cdyl2 / 292044 RGDID:1309548 Length:551 Species:Rattus norvegicus


Alignment Length:299 Identity:68/299 - (22%)
Similarity:113/299 - (37%) Gaps:53/299 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RRLMSTNPAPVANKHLHTKV----------------VNGVLVIKIDSPNAKVNSLGSEVSDEFER 85
            :|.:.|....|.:|.|...|                ..|...|.:.|..:..|:|..|:..|..|
  Rat   266 KRKLETEKDYVFDKRLRYSVRQNESNCRFRDIVVRKEEGFTHILLSSQTSDNNALTPEIMKEVRR 330

  Fly    86 VIKDLETNPAVNSAVLISGKPGCFVAGAD----IGMLEACQTAEEATLISHGAQVMFDRMERSKK 146
            .:.:..|:.  :..:|:|.....|.:|.|    ||.|.: ...:|:|.|:...:.......:.||
  Rat   331 ALCNAATDD--SKLLLLSAVGSVFCSGLDYSYLIGRLSS-DRRKESTRIAEAIRDFVKAFIQFKK 392

  Fly   147 PIVAAISGVCLGGGLELALACHYRIATKDSKTKLGLPEVMLGLLPGGGGTVRLPKLTSVPTALDM 211
            |||.||:|..||.|..:...|.  |.....|.....|...:.|.|.|..:...|::..|..|.:|
  Rat   393 PIVVAINGPALGLGASILPLCD--IVWASEKAWFQTPYATIRLTPAGCSSYTFPQILGVALANEM 455

  Fly   212 ELTGKQVRADRAKRLGIVDLLVDPLGPGLQPAEQNTIEYLEKTAVQVANDLASGKLRVNREKSGL 276
            ...|:::.|..|...|:|..:..|            ..:.::..::| .::||....|..:...|
  Rat   456 LFCGRKLTAQEACSRGLVSQVFWP------------TTFSQEVMLRV-KEMASCSAVVLEDSKCL 507

  Fly   277 VSKIQSFVMDTDFVKNKIFDTARKQVL------KASNGL 309
            |         ..|:|:.:.|...|:.|      .:|.||
  Rat   508 V---------RSFLKSVLEDVNEKECLMLKQLWSSSKGL 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MtpalphaNP_609299.1 fa_ox_alpha_mit 38..775 CDD:131494 68/298 (23%)
crotonase-like 52..235 CDD:119339 49/202 (24%)
3HCDH_N 375..553 CDD:280833
3HCDH 556..651 CDD:279114
3HCDH 689..768 CDD:279114
Cdyl2XP_017456726.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.