DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mtpalpha and Eci2

DIOPT Version :9

Sequence 1:NP_609299.1 Gene:Mtpalpha / 34276 FlyBaseID:FBgn0028479 Length:783 Species:Drosophila melanogaster
Sequence 2:NP_001006967.1 Gene:Eci2 / 291075 RGDID:1359427 Length:391 Species:Rattus norvegicus


Alignment Length:306 Identity:62/306 - (20%)
Similarity:109/306 - (35%) Gaps:44/306 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SAVGQISRQQLLQNKCTRALPISAQLLQRRRLMSTNPAPVANKHLHTKVV-----NGVLVIKIDS 67
            :|:|.:.::...||    .:.:.:.|.......|........|...:|.:     .|:..|..:.
  Rat    95 NALGSLPKETARQN----YVDLVSSLSSSSEASSQGKGGADGKAQESKGILVTSEGGITKITFNR 155

  Fly    68 PNAKVNSLGSEVSDEFERVIKDLETNPAVNSAVLISGKPGCFVAGADI--------GMLEACQTA 124
            |:.| |::..::..:....:|:..|:..|  ..:.:|....:.:|.|:        ||.||..  
  Rat   156 PSKK-NAITFQMYQDIILALKNASTDDTV--ITVFTGAGDYYSSGNDLTNFTSASGGMEEAAN-- 215

  Fly   125 EEATLISHGAQVMFDRMERSKKPIVAAISGVCLGGGLELALACHYRIATKDSKTKLGLPEVMLGL 189
            :.|.::........|    ..||:||.::|..:|..:.| |.....:...|..| ...|...||.
  Rat   216 KGAIVLREFVNTFID----FPKPLVAVVNGPAVGISVTL-LGLFDAVYASDRAT-FHTPFSHLGQ 274

  Fly   190 LPGGGGTVRLPKLTSVPTALDMELTGKQVRADRAKRLGIVDLLVD----------------PLGP 238
            .|....:...||:.....|.:|.|.||::.|..|...|:|..:..                .|.|
  Rat   275 SPEACSSYTFPKMMGSAKAAEMLLFGKKLTAREAWAQGLVTEVFPESTFETEVWTRLKTYAKLPP 339

  Fly   239 GLQPAEQNTIEYLEKTAVQVANDLASGKLRVNREKSGLVSKIQSFV 284
            ......:..|...||..:...|:.....||........::.|.|||
  Rat   340 NSMRISKELIRKNEKEKLHAVNEEECTTLRARWLSEECINAIMSFV 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MtpalphaNP_609299.1 fa_ox_alpha_mit 38..775 CDD:131494 57/276 (21%)
crotonase-like 52..235 CDD:119339 43/211 (20%)
3HCDH_N 375..553 CDD:280833
3HCDH 556..651 CDD:279114
3HCDH 689..768 CDD:279114
Eci2NP_001006967.1 ACBP 38..113 CDD:279259 4/21 (19%)
Acyl-CoA binding. /evidence=ECO:0000250 64..68
crotonase-like 134..389 CDD:304874 55/263 (21%)
ECH-like 149..319 41/180 (23%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:Q05871 196..200 1/3 (33%)
Microbody targeting signal. /evidence=ECO:0000255 389..391
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1024
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.